DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ea and CG18754

Sequence 1:NP_524362.2 Gene:ea FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster

Alignment Length:383 Identity:122/384 (32%)
Similarity:175/384 (46%) Gaps:76/384 (20%)


  Fly    21 QFYFPNEAAQVPNYGRCITPNRERALCIHLEDCKYLYGLLTTTPLRDTDRLYLSRSQCGY-TNG- 83
            |..|.|:.|:......|    ::...|..|..|..|..:|....:...::...:..|||. .|| 
  Fly    14 QAIFFNQLAECVRLSSC----QKDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGH 74

  Fly    84 ----KVLICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCGN---ILSNRIYGGMKTKIDEFPW 141
                .|.:|||:                  ...:||....||.   :..:|  |....:::|:||
  Fly    75 ELLHMVYVCCPE------------------LGDVLPNKQTCGQTTPVFRDR--GAENAELNEYPW 119

  Fly   142 MALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKAL-PTDWRLSGVRLGEWDTNTNPDCEVD 205
            |.|:.|....         |||  |||:||:|||.|..| ..|..|..|||||..|    ||   
  Fly   120 MVLLLYENRL---------SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTT----DC--- 166

  Fly   206 VRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICL-----PL-D 264
            :.....|  |||||.|.:|..|..:..:.....||||||||...|.||..::||||     || |
  Fly   167 ITSESRC--PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQD 229

  Fly   265 VNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKE 329
            :||:          ::||..|:   :|...:.:.|:.....:|.|.|.|   ....:|:||||:.
  Fly   230 LNLQ----------ISGWDPTK---SSQTLITSTVKERNPADCLNRYPS---FRSASQVCAGGQR 278

  Fly   330 GVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQ 387
            ..|:|.|.||.|::|:..:.|:.:.||||:.|:|...|..||.|||||.:|.:.:||:
  Fly   279 KGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 13/58 (22%)
Tryp_SPc 127..386 CDD:214473 98/266 (37%)
Tryp_SPc 128..389 CDD:238113 98/268 (37%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 12/49 (24%)
Tryp_SPc 108..338 CDD:238113 98/266 (37%)
Tryp_SPc 108..335 CDD:214473 97/263 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D402896at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.