DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ea and CG10663

Sequence 1:NP_524362.2 Gene:ea FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster

Alignment Length:371 Identity:106/372 (28%)
Similarity:158/372 (42%) Gaps:95/372 (26%)


  Fly    77 QCG----------YTNGKVLICCPDRYRESSSETTP-------------------PPKPNVTSNS 112
            |||          ||.|.  .|  .::.::..:.||                   ..:|.|:.|.
  Fly   407 QCGREVLREIAYCYTEGS--FC--QQWLQTQFQKTPAFETRPGSGSPANAMRRMQSEQPEVSMND 467

  Fly   113 L--------------LPLPGQCGNI--------LSN--RIYGGMKTKIDEFPW-MALIEYTKSQG 152
            |              .||...||.:        :||  :|.||...:..|:|| :|::...|.. 
  Fly   468 LNYIMTGKGYRGPEYTPLKLSCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILNRFKEA- 531

  Fly   153 KKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHL 217
                .|||:||:.|:|:||:|||.        ::..||:||.:.|.....|:.:|.||....|:.
  Fly   532 ----FCGGTLIAPRWVLTAAHCVR--------KVLFVRIGEHNLNYEDGTEIQLRVMKSYTHPNF 584

  Fly   218 DVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGW 282
            |   :||:.            :|:|||||.:.|..|.::...|||...   .|....:...:.||
  Fly   585 D---KRTVD------------SDVALLRLPKAVNATTWIGYSCLPQPF---QALPKNVDCTIIGW 631

  Fly   283 GKTEQLSASNLKL--KAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEG-VDSCRGDSGGPLIG 344
            ||.....|:...:  ||.|....|..|:.||  .|..:.....|||.::| :|:|.|||||||:.
  Fly   632 GKRRNRDATGTSVLHKATVPIIPMQNCRKVY--YDYTITKNMFCAGHQKGHIDTCAGDSGGPLLC 694

  Fly   345 LDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            .||.|.|..:.:.|:.||| ..|......|:|..|..||||:.:.:
  Fly   695 RDTTKPNHPWTIFGITSFG-DGCAQRNKFGIYAKVPNYVDWVWSVV 739

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 7/22 (32%)
Tryp_SPc 127..386 CDD:214473 87/263 (33%)
Tryp_SPc 128..389 CDD:238113 87/265 (33%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 87/263 (33%)
Tryp_SPc 507..735 CDD:238113 87/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24256
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.