DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ea and CG14227

Sequence 1:NP_524362.2 Gene:ea FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster

Alignment Length:289 Identity:93/290 (32%)
Similarity:133/290 (46%) Gaps:48/290 (17%)


  Fly   116 LPGQCGNILSNRI------YGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHC 174
            |..:||..|....      |....|.|...||:..:..   .||.  .|.||||:.|:|:||:||
  Fly    27 LDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIV---NGKA--KCSGSLINHRFVLTAAHC 86

  Fly   175 VNGKALPTDWRLSGVRLGEWDT-NTNPDCEVDVR-GMKDCAPPHLDVPVERTIPHPDYIPASKNQ 237
            |..:|:.       |.||::|. |...:|....| ....|      |.:::.|.|..:......|
  Fly    87 VFREAMQ-------VHLGDFDAWNPGQNCSSGARLSNAYC------VRIDKKIVHAGFGKIQAQQ 138

  Fly   238 VNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKT-EQLSASNLKLKAAVEG 301
            . ||.|||:...|:|:||||||||.  :|...|..|...:.|  ||.| |...:....||.:| |
  Fly   139 Y-DIGLLRMQHAVQYSDFVRPICLL--INEPVAAIDRFQLTV--WGTTAEDFRSIPRVLKHSV-G 197

  Fly   302 FRMDE--CQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIG--LDTNKVNTYYFLAGVVSF 362
            .|:|.  |...:..|   ::::|:|. ..|...:|:||||||...  |......|:.|  |::.|
  Fly   198 DRIDRELCTLKFQQQ---VDESQICV-HTETSHACKGDSGGPFSAKILYGGTYRTFQF--GIIIF 256

  Fly   363 GPTPC-GLAGWPGVYTLVGKYVDWIQNTI 390
            |.:.| ||:    |.|.|..|:|||.:.:
  Fly   257 GLSSCAGLS----VCTNVTFYMDWIWDAL 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 88/273 (32%)
Tryp_SPc 128..389 CDD:238113 89/275 (32%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 85/254 (33%)
Tryp_SPc 57..277 CDD:238113 85/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24256
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.