DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6236 and CG11630

Sequence 1:NP_650446.2 Gene:CG6236 FlyBaseID:FBgn0038318 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster

Alignment Length:705 Identity:177/706 (25%)
Similarity:299/706 (42%) Gaps:123/706 (17%)


  Fly    15 CCCVVVLLV---TWYVLNVERDLDKSLKIEIIERSIRSAVNRGECRHPHLPLDNPDIMKFYKPVE 76
            ||.:..|::   .:|..:|..|.....:..::|   :.:|:...||...:..:..|:|..::.:.
  Fly     8 CCFLYSLIIFSFVYYYNDVVVDNIIFEEHHLVE---KYSVDTKGCRMLTMVPNEYDVMFLWRGLR 69

  Fly    77 RINCGEGMDWVMCEKSIC---FVRPEI----------ASSHEDVICSYTDIIRKSDYKVRFGQSL 128
            |..|...::  :...|.|   ::|.|:          ..:.|...|.|..:.|.:|:..|:..|.
  Fly    70 RDFCASNLN--LTSFSNCTYNYLRTEVNMELAKARFGVETLESFKCMYYAMERHTDFDNRYLYSR 132

  Fly   129 RMK---------EPYVLQASDFVKVVCRSSSGESWFGMAHGIRDTVPRPPASNFSPNLAVLPPEA 184
            ..:         ||:    :|.::..|..::...:.|:...:.      |...:......|||..
  Fly   133 EFELLTDGNNTIEPH----ADIIRAECFINATSIYNGVHFYVH------PTDEWLRTAQGLPPLK 187

  Fly   185 VAQAQQQMQDGATAPIYNVLMFGFDSLSRNAFIRKLPRTYEYLTQQLGATVLKGYNIVGDGTPQA 249
            :|.....:         :||:.|.||:|:..|.|.:.||..:|. .|....|||:|.:|:....:
  Fly   188 LASDVGSL---------SVLIVGLDSISQMHFHRSMARTANFLL-SLPHVELKGFNRLGEDGFDS 242

  Fly   250 LVPLLTGFTELELPETRKRLSGAGSVDSYPMIWKDFARLGYMTSFNEDLPNVGTFTYRMTGFEAQ 314
            |:|||:|.:..||.:....||   |:||.|.|||.|.:.||.|...||..:...|   :.||...
  Fly   243 LMPLLSGLSGQELKDVSSNLS---SLDSCPFIWKVFQKAGYETGLGEDNIDKSLF---VKGFRKP 301

  Fly   315 PVDHYLRTYYVQAEHMAAESK------PNCIGHQPDHITMLEYTKNF---MLKYRDAPRFAFSF- 369
            |.|.|||...::   |..:::      .:|  ::.|:..|:  .:.|   ||.:..:.|| |:| 
  Fly   302 PTDFYLRPALLE---MWLKTRTDGLFGTHC--NEKDNYAMV--LREFLFKMLPHHTSHRF-FTFL 358

  Fly   370 --HGGLSHDSINLVGAADDDVHDWLVALKERSLLDDTILIMMADHGNRFAEVRATLQGKQEERLP 432
              ..|:.| ..|.....|........|:....||.:|:|:::::||........|:|||.||..|
  Fly   359 WWTQGIDH-LFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEESQP 422

  Fly   433 FFSFVFPESFKKRFPQEYKNFLANEHHLTTPFDIHATLKHVIQLQTAVDQFGEINDPKTETSPPG 497
            .....:|...::|:||...|..:|...|.|.||:||||:::..|.:..|:  ::...:.:....|
  Fly   423 LAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDE--QLQQRRVDLWAMG 485

  Fly   498 IRISELARGRAMSLLDPIPSNRSCADAYIEPHWCACLNWLPLQLNDSRYTGIILKAAQSIVNAIN 562
               .::.||  :||..|||.:|.|..|.|....|.|..    ..|.|...|.:.:||:.|:..:|
  Fly   486 ---KDIPRG--ISLFLPIPDHRDCFLAAIPTANCLCQQ----PRNVSTSDGYVQRAARLIIRNLN 541

  Fly   563 LATVEQRQYCAPLEIHRV----NWALRLQPHKELLQFRTNSDRDGFLADMTGQTLVRDEMYQLQV 623
            .........|..|.:.||    .|......|:.  :||                        :::
  Fly   542 KMIHTHTPPCKTLYLDRVLTADKWRRIADEHQS--EFR------------------------VRL 580

  Fly   624 VTMPGEGLFEASVAYSLHTFSATTKLTDISRVNKYGNQARCIYDRDPELRKYCYC 678
            :..||||.||..|.|:.:..:..   ..|||||.|.|.::||  |:..:..||:|
  Fly   581 IATPGEGQFEGIVRYTGYKLAVD---GHISRVNDYRNGSQCI--RNYLIEMYCFC 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6236NP_650446.2 DUF229 73..581 CDD:281053 140/546 (26%)
ALP_like 201..477 CDD:293745 91/288 (32%)
CG11630NP_610124.1 DUF229 66..560 CDD:281053 140/542 (26%)
ALP_like 195..467 CDD:293745 91/297 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.