DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and jigr1

DIOPT Version :10

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_651409.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:225 Identity:42/225 - (18%)
Similarity:90/225 - (40%) Gaps:40/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEKNPGASLAKWTNLRISF---RREYTNYL 94
            ||...:....:|:..:|.:..:.||.:.|.::..||..:..:...:.|.||..:   :|...|.|
  Fly    33 LIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVENGL 97

  Fly    95 EEKVPPCWSYFDRMFFLHPYLRK----KHQQPKSLDTQV-------QDALAHLSNLSSRMQRERS 148
            ..:... |..|:.:.||..::|.    |:...|..|.:.       .|:..|::::...::.:..
  Fly    98 STQSSQ-WPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDDSE 161

  Fly   149 V-----TIPGSSSIGGQPTPSAHQSPPAQQLDN--------YLDYFDEAEHNNSE------LDDI 194
            :     .:| .:::.|.|..::.::..:|:..|        | ::|.|:.|...:      :...
  Fly   162 IFDCEQALP-VTTVLGIPLNNSDEANKSQRSTNGEMPNGKGY-NHFAESYHRRHQNQPEYIISSP 224

  Fly   195 MEEEQQRNSRYHGQLDGNDIKSECEEPVDD 224
            :....:.|.|....||.:..|..    |||
  Fly   225 IVNPMRSNKRGSQHLDDHPSKRR----VDD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 19/85 (22%)
BESS 431..465 CDD:460758
jigr1NP_651409.1 MADF 33..118 CDD:214738 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.