DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6276 and CG12768

Sequence 1:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster

Alignment Length:479 Identity:89/480 (19%)
Similarity:152/480 (32%) Gaps:180/480 (38%)


  Fly    32 KLIEIVQRDEAIYN---PRHKYYFCRPYVENFWREVDLKLEKNPGASLAKWTNLRISFRREY--- 90
            :|||:|:.:..:::   |.:|....|..::  |.|:......|.......:|:||..||||.   
  Fly    12 RLIELVRLNPILWDCRLPHYKRSDKRKAIK--WNELGRLFNVNGERVQRTFTSLREIFRRELNHE 74

  Fly    91 ----TNYLEEKVPPCWSYFDRMFFLHPYLRKKHQQPK----SLDTQVQDALAHLSNLSSRMQRER 147
                |...:.|    |.|:|.|.||...:|::..:.:    |||: ...|....:|.::.:.|. 
  Fly    75 KMLGTTRFKSK----WEYYDAMAFLKEVIRERKSRERIKHGSLDS-APVATGSSNNNNNCVSRN- 133

  Fly   148 SVTIPGSSSIGGQPTPSAHQSPPAQQLDNYLDYFDEAEHNNSELDDIMEEEQQRNSRYHGQLDGN 212
                            |::.:..:..||.| .||..::.||..                      
  Fly   134 ----------------SSNNNSSSAALDEY-QYFAPSDPNNPN---------------------- 159

  Fly   213 DIKSECEEPVDDYEQEAHEPEEDEQDDQDLHKMAPTSSSSSAEAQRRYANQHSHASRMLPGRLQM 277
                             ::|:...:....|....|:.|.:.::               ||..||.
  Fly   160 -----------------NQPQLQPEPKSSLPVTIPSLSLTLSQ---------------LPVALQQ 192

  Fly   278 RTYHDEMRGAIRPRSQELQ-APTAAVAGVNYSAQPTAHPNISFVRPTFSKPVDLVSTT------- 334
            :..|          .|.|| .|...:..:...:.||:..|.:......:.|..::|::       
  Fly   193 QAQH----------LQALQLQPDVTLTSLQKQSLPTSLTNATPAPLAQTSPAQVLSSSRSCSSSP 247

  Fly   335 ---------THAGG-------GGGGGV---------PGTAGLSEA--ELPTPSTAAVATPMAPSS 372
                     :.|||       |.|...         |.|....:|  :||||             
  Fly   248 SIYIKDEPCSPAGGCPEEVMTGNGPEATRKKLATIRPQTKQQLKARLQLPTP------------- 299

  Fly   373 SVSASSSSSYLSQRHGHNHMHGGHPQVPPSALPLRLEANN----ASGGSVSNGGAELCDCKTDPD 433
                .:||||.:.              ||.   |.:.|||    ...|.:..   :|.|...|.|
  Fly   300 ----KNSSSYATS--------------PPH---LIINANNELIDTDAGDLEE---DLDDFDEDDD 340

  Fly   434 AMFLMSLLPDIQKLNGRDRGKIKI 457
            .....|.:....:..|.| |::.:
  Fly   341 VTGRCSPIVGQSETMGAD-GRLSV 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 25/94 (27%)
BESS 431..465 CDD:281011 6/28 (21%)
CG12768NP_001262229.1 MADF 12..100 CDD:214738 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48416
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.