DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6276 and stwl

Sequence 1:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster

Alignment Length:645 Identity:103/646 (16%)
Similarity:200/646 (31%) Gaps:227/646 (35%)


  Fly    33 LIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEKNPGASLAKWTNLRISFRREYTNYLEEK 97
            |:..|::..|:|:...:.|..|...||.|..|..::.::......:|..|    |.:||.:....
  Fly    11 LLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQL----RNDYTRWCNAD 71

  Fly    98 VPP--------CWSYFDRMFFLHPYL-------------------RKKHQQPKSLDTQVQDALAH 135
            ...        .:...|.:.||..:|                   |..::..:.:|...|.:|..
  Fly    72 ANRRRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQASLKE 136

  Fly   136 LSNLSSRMQRERSVTIPGSSSIGGQPTPSAHQSP---------PAQQLDNYLDYFDEAE------ 185
            .::.:|::.:|..:..........|......::|         .|::..|.|:..||.|      
  Fly   137 RASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDEPEKVPELD 201

  Fly   186 ---HNNSELDDIMEEE----------------QQRNSRYHGQLDGNDIKSECEEPVDDYEQEAHE 231
               .:::|.|:.|:||                |::.......|:.|:..|...:| :.:.::..:
  Fly   202 SFLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQEKELTPEKSLEKNNTDSTVSQP-EFFVKQTRD 265

  Fly   232 PE-------------------------------EDEQDD--QDLHKMAPTSSSSSAEAQRRYANQ 263
            |.                               ||..|:  :|..|....|.::|...:.|.|.:
  Fly   266 PRLLIIGRKNSTSSFAESKASKSISGDPLETAMEDSGDEYGRDGEKRVTGSDTTSPTRRPRRAAR 330

  Fly   264 HS---------------HASRMLPGRLQ------------MRTYHDEMRGAIRPRSQELQAP--- 298
            .|               .|.||.  |||            :|:....::....||||.:..|   
  Fly   331 ASISFAGIRDLPIQKPGQAQRMT--RLQRRKSMSLAAVHSVRSSTSPVKMTPVPRSQPINKPPSG 393

  Fly   299 -------------------TAAVAGVNYSAQPTAHPNISFVRPTFSKPVDLVSTTTHAGGGGGGG 344
                               .:.|..:|.:...|.....:.:.||..:.:         ....|.|
  Fly   394 PVQITKISHRDDIFPRPAVPSGVVNINQNQLKTQQQQKTLIFPTTDEAI---------ANPQGSG 449

  Fly   345 VP--GTAGLSEAELP---------------TPSTAAVATPMAPSSSV------------------ 374
            .|  .:.|....:||               :|....|.|...|:|||                  
  Fly   450 PPQRRSVGRPPKKLPMVQRIVAPETQTKPQSPINTKVLTIGKPTSSVASGNINNIAIKSNVVTSI 514

  Fly   375 -SASSSSSYLSQRHGHNHMHGGHPQVPPSALPLRLEANNASGGSVSNGGAELCDCKT-------- 430
             |::::::.:::...:|.:.........|..|.....:::|..:....||.:.:..|        
  Fly   515 SSSTATTNTITKGTSNNSIKTTENVNVISYSPNSSSTSSSSKATTGASGAVITNIPTTTTAGTSV 579

  Fly   431 ---------------------DP--DAMFLMSLLPDIQKLNGRDRGKI-KIAFQNILQDY 466
                                 :|  |..||..:.|.:|::|.|.:... |..||.:::.:
  Fly   580 PVGKSITQLKMTERGTQTGVQNPFSDNYFLEMIKPQMQEMNPRQKMHFKKKVFQALMETF 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 19/110 (17%)
BESS 431..465 CDD:281011 11/37 (30%)
stwlNP_001261839.1 MADF 11..98 CDD:214738 19/91 (21%)
BESS 604..637 CDD:281011 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.