DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and CG6163

DIOPT Version :10

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_648460.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster


Alignment Length:185 Identity:37/185 - (20%)
Similarity:67/185 - (36%) Gaps:38/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WREVDLKLEKNPGASLAKWTNLRISF-----RREYTNYLEEKVPPCWSYFDRMFFLHPYLRKKHQ 120
            |:|..:::...|.....:|:.::..:     :..:..|..:.....|.:||||.|:...|.||..
  Fly   257 WKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKKVD 321

  Fly   121 QPKSLDTQVQDALAHLSNLSSRMQRERSVTIPGSSSIGGQPTPSAH------QSPPAQQLDNYLD 179
            :.:....|:|:.::.        |:....|         |..||.|      ..|||..:::..|
  Fly   322 EREQTREQIQEIVSE--------QQHHQQT---------QHHPSQHLHHYRPPQPPAGLVEHAQD 369

  Fly   180 Y-FDEAEHNNSELDD---IMEEEQQRNSRYHGQLDGNDIKSECEEPVDDYEQEAH 230
            . ....:|::.|...   .|...|      |.|.....:|.|.:...|.:|...|
  Fly   370 MPIGLVQHHHQEGHHPTLAMHHPQ------HSQPIRRRVKHESDLEWDPFEMILH 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 11/59 (19%)
BESS 431..465 CDD:460758
CG6163NP_648460.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 11/58 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.