DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6276 and Coop

Sequence 1:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster

Alignment Length:473 Identity:99/474 (21%)
Similarity:168/474 (35%) Gaps:151/474 (32%)


  Fly    13 SSNPNTSCSASRWLT-------EEVFKLIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEK 70
            |::...|.:||...|       |.|.:||..|.|...::...:.....|..:...|.||...:..
  Fly    16 SASAAASATASFAFTNTAKLPIETVKRLIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNL 80

  Fly    71 NPGASLAKWTNLRISFRREY-TNYLEEKVPPCWSYFDRMFFLHPYLRKKHQQPKSLDTQVQDALA 134
            .......||.:||.:||:.| .|.|..:.|..|.:::.|.|:.|.:.:                 
  Fly    81 PADICRIKWGHLRDNFRKVYIRNNLSNETPSSWRFYNDMRFMEPAVHE----------------- 128

  Fly   135 HLSNLSSRMQRERSVTIPGSSSIGGQPTPSAHQSPPAQQLDNY----LDYFDEAEHNNSELDDIM 195
               |:   |::.||               |:.:.||....:|.    .|.:|......:|  .|.
  Fly   129 ---NI---MRQTRS---------------SSKKHPPGHWTENNNVLGPDKYDSMPIVATE--PIC 170

  Fly   196 EEEQQRNSRYHGQLDGNDIKS-----ECEEPVDD-YEQEAHEPEEDEQDDQDLHKMAPTSSSSSA 254
            |.....:|..| |...:||.|     :|:.|.:. ::.|..:.||||:||.|..:.|   :|.:.
  Fly   171 ELSHSYDSELH-QPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFDEDA---ASENL 231

  Fly   255 EAQRRYANQHSHASRMLPGRLQMRTYHDEMRGAIRPRSQELQAPTAAVAGVNYSAQPTAHPNISF 319
            |.:|  .|:...||..: ..:::....|||..|:                               
  Fly   232 EEER--GNRADAASSGV-FTIEVLDDDDEMEQAV------------------------------- 262

  Fly   320 VRPTFSKPVDLVSTTTHAGGGGGGGVPGTAGLSEAELPTPSTAAVATPMAPSSSVSASSSSSYLS 384
                         |.|.|.....||                           ||:.:...:...|
  Fly   263 -------------TKTKANNTSHGG---------------------------SSLKSEQEAKVFS 287

  Fly   385 QRHGHNHMHGGHPQVPPSALPLRLEANNASGGSVSNGGAELCDCKTDPDAMFLMSLLPDIQKLNG 449
                       :.|.|.:.||.:..:.:.:..:..:||    |.:.:.|.|||:||:|.:|:|:.
  Fly   288 -----------NSQSPTADLPFKYISTDVATNTDPSGG----DLQDEADRMFLLSLMPFLQRLDS 337

  Fly   450 RDRGKIKIAFQNILQDYL 467
            |.|.:::...||:|.:.|
  Fly   338 RRRLRVRQKLQNVLIEEL 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 22/85 (26%)
BESS 431..465 CDD:281011 14/34 (41%)
CoopNP_001260776.1 MADF 42..124 CDD:214738 21/82 (26%)
BESS 320..353 CDD:281011 14/33 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.