DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6276 and CG4404

Sequence 1:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster

Alignment Length:472 Identity:90/473 (19%)
Similarity:144/473 (30%) Gaps:211/473 (45%)


  Fly    28 EEVF--KLIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEKNPGASLAKWTNLRISF---- 86
            :.||  :.::.|:....::|..|..|..:..|:..|::|...::........:|..:|.||    
  Fly    11 DPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSL 75

  Fly    87 ----------RREY--TNYLEEKVPPCWSYFDRMFFLHPYLRKK--HQQPKSLDTQVQDALAHLS 137
                      :|:|  :.||:              ||.|:.:.:  |:|                
  Fly    76 KLARTQTGRGKRKYYLSKYLQ--------------FLVPFTKSRSCHKQ---------------- 110

  Fly   138 NLSSRMQRERSVTIPGSSSIGGQPTPSAHQSPPAQQLDNYLDYFDEAEHNNSELD---DIMEEEQ 199
             |...:.|:     ||             |:..|||.|..:...:||:.::.|:.   .:.|||.
  Fly   111 -LPGMVLRK-----PG-------------QAATAQQEDEVVAAEEEAKVSDGEMPLDVQVSEEEH 156

  Fly   200 QRNSRYHGQLDGNDIKSECEEPVDDYEQEAHEPEEDEQDDQD--------LHKMAPTSSSSSAEA 256
            :||                                .|||.:.        ||.:.....||:|..
  Fly   157 RRN--------------------------------QEQDREQPTACLPLRLHSIKVEHDSSNANQ 189

  Fly   257 Q-RRYANQHSHASRMLPGRLQMRTYHDEMRGAIRPRSQELQAPTAAVAGVNYSAQPTAHPNISFV 320
            | .|..:|.|..|                            .|.||:..         |...|  
  Fly   190 QLERMVSQQSLVS----------------------------VPAAALGN---------HLGWS-- 215

  Fly   321 RPTFSKPVDLVSTTTHAGGGGGGGVPGTAGLSEAELPTPSTAAVATPMAPSSSVSASSSSSYLSQ 385
                    ||  |....|.|.|          ..:|.|.:|...:.|..|..:.||.|       
  Fly   216 --------DL--TQWFKGHGSG----------HHKLTTTTTTPTSPPPPPQPATSALS------- 253

  Fly   386 RHGHNHMHGGHPQVPPSALPLRLEANNASGGSVSNGGAELCDCKTDPDAMFLMSLLPDIQKLNGR 450
                  :..|.|                 ||    ||::     .|.|..||:||.|.|:::||:
  Fly   254 ------VFTGGP-----------------GG----GGSQ-----PDADYSFLISLHPYIKEMNGK 286

  Fly   451 DRGKIKIAFQNILQDYL 467
            ...|.:.....::.|.|
  Fly   287 QNRKFRQKVVGLIDDIL 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 18/100 (18%)
BESS 431..465 CDD:281011 11/34 (32%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/100 (18%)
BESS 267..301 CDD:281011 11/34 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48661
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.