DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6276 and CG45071

Sequence 1:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster

Alignment Length:508 Identity:112/509 (22%)
Similarity:184/509 (36%) Gaps:163/509 (32%)


  Fly    30 VFKLIEIVQRDEAIYNPRHKYYFC-RPYVENFWREVDLKLEKNPGASL-AKWTNLRISFRREYTN 92
            |.:.|..::...||:|   :.:.| :.::|..|.|:. ...|.|...| |||..||.:||.||  
  Fly    12 VEQFIHDIEERPAIWN---RNFHCNKAFLEQMWDELS-GAHKLPKIVLKAKWKGLRDNFRVEY-- 70

  Fly    93 YLEEKVPPC---------------WSYFDRMFFLHPYLRKKHQQPKSLDTQVQDALAHLSNLSSR 142
               :::|..               |.::..:.||..::|  |:.||:    .||...:.|..|. 
  Fly    71 ---KRIPRADNGDFMVDPATFESKWLHYYALLFLTDHMR--HRLPKN----EQDQSFYFSQQSE- 125

  Fly   143 MQRERSVTIPGSSSIGGQPTPSAHQSPPAQQLDNYLDYFDEAEHNNSELDDIMEEEQQRNSRYHG 207
             ..|::|..|..::                .|...|...||         |..|||.        
  Fly   126 -DCEKTVVEPDLTN----------------GLIRRLQDSDE---------DYDEEEM-------- 156

  Fly   208 QLDGNDIKSECEEPVDDYEQEAHEPEEDEQDDQDLHKMAPTSSSSSAEAQRRYANQHSHASRMLP 272
            :.||...::..||.:.. ...||:          :::::.|..::.|...:..|:||:.....|.
  Fly   157 EADGEASEATMEETMPT-PPAAHQ----------MNQVSTTPLATGALRAQEEAHQHALIKAGLL 210

  Fly   273 GRLQMRTYHDEMRGAIR--PRSQELQAPTAAVAGVNYSAQPTAHPNISFVRPTFSKPVDLVSTTT 335
             |.|:.....|.....|  |..|::.:|.|....| ....|.||          ..|..:|:||:
  Fly   211 -RAQLMELEKEAEDLSRKPPPPQQMTSPVAPSLQV-LVEPPAAH----------CSPPPMVTTTS 263

  Fly   336 HAGGGGGGGVPGTAGLSEAELPTPSTAAVATPMAPSSSVSASSSSSYLSQRHG---------HNH 391
                              |::..|.:|||   :||:::.||||.||..:...|         :|.
  Fly   264 ------------------AQVQQPGSAAV---LAPATTTSASSVSSNGAPMGGKRSVSPPPLYNK 307

  Fly   392 MHGGHPQVPPSALPLRLEANN-------ASGG----------SVSNG------------------ 421
            .|  ||....:|..|..:..|       |.||          |.:||                  
  Fly   308 AH--HPLATLAAAHLAAKDRNEDFGPTSAVGGNGDHLSFTQHSYANGLIPALKLKRPRLSEDSNF 370

  Fly   422 -GAELCD---CKTDPDAMFLMSLLPDIQKLNGRDRGKIKIAFQNILQDYLYPD 470
             |:...|   ...|.|..:|:||.|.:::|....:.:|:...|.::...||.:
  Fly   371 NGSSTMDTPLVPEDDDYHYLLSLHPYMKQLTAAQKLRIRTKIQKLIFKELYKE 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 24/101 (24%)
BESS 431..465 CDD:281011 9/34 (26%)
CG45071NP_730024.1 MADF 14..106 CDD:214738 24/101 (24%)
BESS 384..418 CDD:281011 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.