DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42404 and Dgcr2

Sequence 1:NP_001247118.1 Gene:CG42404 FlyBaseID:FBgn0259823 Length:1133 Species:Drosophila melanogaster
Sequence 2:NP_001012146.1 Gene:Dgcr2 RGDID:1310567 Length:546 Species:Rattus norvegicus

Alignment Length:201 Identity:59/202 (29%)
Similarity:90/202 (45%) Gaps:43/202 (21%)


  Fly    28 SCRDYNGKMYETGMHYMP-GPDSCRLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVIC 91
            :|.|....:.:.|.::.| |.|.|..|.|..|.|:.|...|||....|:.::.  ....||:.:|
  Rat   266 TCVDIKDNVVDEGFYFTPKGDDPCLSCTCHRGEPEMCVAALCERPQGCQQYRK--DPKECCKFMC 328

  Fly    92 LDDQFSDGSTDF-----GIXLVASGITATLSLSLLFFLVNRLRQRKMRARENRQNAEDQRSIVGS 151
            ||   .|||:.|     |: ||.|.:::.|.||||.|:|:|||||:      |:..|   |::|:
  Rat   329 LD---PDGSSLFDSMASGMRLVVSCVSSFLILSLLLFMVHRLRQRR------RERIE---SLIGA 381

  Fly   152 -----------IGYIAGNMGYMEGNLSAIDYSYSGAATHYPLWKPHFP-----------RGEAPP 194
                       .|:..|..|:..| |:.:..|..|....:....|..|           ..:.||
  Rat   382 NLHHFNLGRRIPGFDYGPDGFGTG-LTPLHLSDDGEGGTFHFHDPPPPYTAYKCPDLDQPDDPPP 445

  Fly   195 PYEEAV 200
            |||.::
  Rat   446 PYEASI 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42404NP_001247118.1 VWC 32..89 CDD:214564 16/58 (28%)
Dgcr2NP_001012146.1 LDLa 30..66 CDD:238060
CLECT_DGCR2_like 111..263 CDD:153069
VWC 267..325 CDD:214564 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T618658
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.