DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42404 and CG32647

Sequence 1:NP_001247118.1 Gene:CG42404 FlyBaseID:FBgn0259823 Length:1133 Species:Drosophila melanogaster
Sequence 2:NP_001285168.1 Gene:CG32647 FlyBaseID:FBgn0052647 Length:233 Species:Drosophila melanogaster

Alignment Length:108 Identity:33/109 (30%)
Similarity:42/109 (39%) Gaps:31/109 (28%)


  Fly    29 CRDYNGKMYETGMHYMPGPDSCRLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLD 93
            |.|:.|.....||.|:|||..|.||:|....|..||.:.|:....||:|:.   |..|||..|||
  Fly   122 CVDFQGNKVNHGMLYVPGPGVCSLCVCYHSEPLWCKAIYCDPPYFCKNFRV---GERCCEFECLD 183

  Fly    94 DQFSDGSTDFGIXLVASGITATLSLSLLFFLVNRLRQRKMRAR 136
            ....|                            :|.|.:||.|
  Fly   184 PPGED----------------------------KLYQERMRKR 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42404NP_001247118.1 VWC 32..89 CDD:214564 22/57 (39%)
CG32647NP_001285168.1 VWC 130..178 CDD:302663 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CIGI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR15256
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.