DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42404 and CG32647

DIOPT Version :10

Sequence 1:NP_650437.4 Gene:CG42404 / 41842 FlyBaseID:FBgn0259823 Length:1133 Species:Drosophila melanogaster
Sequence 2:NP_727642.1 Gene:CG32647 / 326226 FlyBaseID:FBgn0052647 Length:233 Species:Drosophila melanogaster


Alignment Length:108 Identity:33/108 - (30%)
Similarity:42/108 - (38%) Gaps:31/108 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CRDYNGKMYETGMHYMPGPDSCRLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLD 93
            |.|:.|.....||.|:|||..|.||:|....|..||.:.|:....||:|:.   |..|||..|||
  Fly   122 CVDFQGNKVNHGMLYVPGPGVCSLCVCYHSEPLWCKAIYCDPPYFCKNFRV---GERCCEFECLD 183

  Fly    94 DQFSDGSTDFGIXLVASGITATLSLSLLFFLVNRLRQRKMRAR 136
            ....|                            :|.|.:||.|
  Fly   184 PPGED----------------------------KLYQERMRKR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42404NP_650437.4 VWC 32..89 CDD:214564 21/56 (38%)
CG32647NP_727642.1 VWC 130..178 CDD:450195 19/50 (38%)

Return to query results.
Submit another query.