DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42404 and LOC100910275

Sequence 1:NP_001247118.1 Gene:CG42404 FlyBaseID:FBgn0259823 Length:1133 Species:Drosophila melanogaster
Sequence 2:XP_006240737.1 Gene:LOC100910275 RGDID:6499160 Length:549 Species:Rattus norvegicus

Alignment Length:201 Identity:59/202 (29%)
Similarity:90/202 (45%) Gaps:43/202 (21%)


  Fly    28 SCRDYNGKMYETGMHYMP-GPDSCRLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVIC 91
            :|.|....:.:.|.::.| |.|.|..|.|..|.|:.|...|||....|:.::.  ....||:.:|
  Rat   269 TCVDIKDNVVDEGFYFTPKGDDPCLSCTCHRGEPEMCVAALCERPQGCQQYRK--DPKECCKFMC 331

  Fly    92 LDDQFSDGSTDF-----GIXLVASGITATLSLSLLFFLVNRLRQRKMRARENRQNAEDQRSIVGS 151
            ||   .|||:.|     |: ||.|.:::.|.||||.|:|:|||||:      |:..|   |::|:
  Rat   332 LD---PDGSSLFDSMASGMRLVVSCVSSFLILSLLLFMVHRLRQRR------RERIE---SLIGA 384

  Fly   152 -----------IGYIAGNMGYMEGNLSAIDYSYSGAATHYPLWKPHFP-----------RGEAPP 194
                       .|:..|..|:..| |:.:..|..|....:....|..|           ..:.||
  Rat   385 NLHHFNLGRRIPGFDYGPDGFGTG-LTPLHLSDDGEGGTFHFHDPPPPYTAYKCPDLDQPDDPPP 448

  Fly   195 PYEEAV 200
            |||.::
  Rat   449 PYEASI 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42404NP_001247118.1 VWC 32..89 CDD:214564 16/58 (28%)
LOC100910275XP_006240737.1 LDLa 30..66 CDD:238060
CLECT_DGCR2_like 114..266 CDD:153069
VWC 270..328 CDD:214564 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15256
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.