DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amt and rhag

DIOPT Version :8

Sequence 1:NP_001097800.1 Gene:Amt / 41841 FlyBaseID:FBgn0038309 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001039257.1 Gene:rhag / 734123 XenbaseID:XB-GENE-5797751 Length:473 Species:Xenopus tropicalis

Alignment Length:460 Identity:97/461 (21%)
Similarity:165/461 (36%) Gaps:117/461 (25%)


  Fly    13 SNYVIPGLYDLSVEDTNWVLTSSFIIFTMQTGFGMLES-------GCVSIKNEVNIMMKNVI--- 67
            :|..:...:||   ||.:.|... :...:..|.|:|.|       |.:::    |:::.|..   
 Frog    44 ANITVANTHDL---DTYFPLFKD-VQLMLFVGLGLLLSFLKLYGFGAMAL----NLVIANFSIQW 100

  Fly    68 DIVLGGFTYWLFGYGMSFGRGPLSNPFIAIGDFLLDPPVGDALMGQIFAAFLFQLSFATTATTIV 132
            .:::.||.|......:.||   |.|                          :....||.....|.
 Frog   101 AVLVQGFFYHYRDGKIHFG---LEN--------------------------VMHAEFAAVTALIS 136

  Fly   133 SGAMAERCNFKAYCLFSFLNTAVYCIPAGWVWGEHGFLNKLGAVDIAGSGPVHLIGGASAFASAA 197
            :||:..|.:.....|.|.|...::.: ..|:...:..:     :||.|:..:|:      |:...
 Frog   137 AGAILGRSSPVQLLLMSMLEIPLFVL-NDWLINYYFHI-----IDIGGTVAIHV------FSCYF 189

  Fly   198 MLGPRLGRYSEGYDPLPLGNPVN---------ACMGLFVLWWGWLAFNSGSTYGVSGAKWQYAAR 253
            .||.....|..|   |..|:..|         :.:|..:||..|.:|||     |.....:...|
 Frog   190 GLGVSRILYRPG---LRAGHSKNITTSTTDLLSLLGSIILWIFWPSFNS-----VLAKSAEARHR 246

  Fly   254 AAVMTMMG-SFGGGFTSSIYSFWRHGGGMDIMDLINGVLGSLVSITAGC-FLYRAWEALVIGAIG 316
            |.:.|.:. ||....|.::.|.....|.::::.|.|.:|...|::.|.. .:.....|..:|.|.
 Frog   247 AVLNTFLALSFSTLTTFAVSSLMDKRGRINLVHLQNSILAGGVAVGASADMMITPAGASGLGCIA 311

  Fly   317 SLFCVLAM----PLFDR-MGVDDPVGASAVHGVCGIWGVIA--VGLFADNPIPLDTTNGRSGLFK 374
            :..|:|..    |..:| :.|.|..|...:||:..|:|.:.  :.:..|.   :||  |...|..
 Frog   312 AFSCILGFQYISPFLERKLKVQDQCGIHNLHGLPAIFGTLGSILAILLDR---VDT--GGHNLHT 371

  Fly   375 G--------------------GGWYLLGIQTLSALCLACWGVCSTFLLL--YVINKII--PIRMD 415
            |                    |.|.... |.|:.  .|..||.....||  |:...:|  |..:.
 Frog   372 GFTPDISIGKESLILDEVEVNGAWNATD-QALNQ--AAALGVTFGVSLLGGYITGLLIKPPCLVH 433

  Fly   416 PHEEL 420
            |.:|:
 Frog   434 PSDEM 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AmtNP_001097800.1 Ammonium_transp 30..428 CDD:275788 92/444 (21%)
rhagNP_001039257.1 Ammonium_transp 54..443 CDD:275788 95/451 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D910733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.