DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amt and rhcgl1

DIOPT Version :8

Sequence 1:NP_001097800.1 Gene:Amt / 41841 FlyBaseID:FBgn0038309 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001103313.1 Gene:rhcgl1 / 563826 ZFINID:ZDB-GENE-060209-2 Length:471 Species:Danio rerio

Alignment Length:458 Identity:98/459 (21%)
Similarity:155/459 (34%) Gaps:99/459 (22%)


  Fly    25 VEDTNWVLTSSFIIFTMQTGFGMLESGCVSIKNE-----VNIMMKNVIDIVLGGFTYWLF----- 79
            |::||..::...:.|..|....:|....:....|     :....||.|...|....|:.:     
Zfish     2 VKNTNIRISLPAVCFVWQIAMIILFGVFIRYNEESDSHWIETRKKNNISTDLENDFYYRYPSFQD 66

  Fly    80 -------GYGM--------SFGRGPLSNPFIAIG-DFLLDPPVGDALMGQIFAAF---------- 118
                   |:|.        |||....:.|..|.| .:.|       ||...|.:|          
Zfish    67 VHVMIFVGFGFLMTFLKRYSFGSVGFNFPIAAFGIQWAL-------LMQGWFHSFDKEDLKIKIG 124

  Fly   119 ---LFQLSFATTATTIVSGAMAERCNFKAYCLFSFLNTAVYCIPAGWVWGEHGFLNKLGAVDIAG 180
               |....|......|..||...:.:.....:.:.....:|.:.      |:..|:.|...|..|
Zfish   125 VENLINADFCVAGCLIAYGACLGKVSPVQLMVLTLFGVTLYAVE------EYIILDLLHVRDAGG 183

  Fly   181 SGPVHLIGGASAFA-SAAMLGPRLGRYSEGYDPLPLGNPVNACMGLFVLWWGWLAFNSGSTYGVS 244
            |..:|..|...... |..:..|.|.: |.........:.|.|.:|...||..|.:|||.......
Zfish   184 SMVIHTFGAYYGLTISWVLYRPFLSQ-SNHLQRSVYHSDVFAMIGTLFLWMFWPSFNSAIADHGD 247

  Fly   245 GAKWQYAARAAVMTMMGSFGGGFTS-SIYSFWRHGGGMDIMDLINGVL-GSLVSITAGCFLYRAW 307
            |..     |||:.|.:.......|: ::.|..:..|.:|::.:.|..| |.:...||..|:...:
Zfish   248 GQH-----RAAINTYLSLAASVLTTFALSSLSKKYGKLDMVHIQNATLAGGVAMGTASEFMITPY 307

  Fly   308 EALVIGAIGSLFC---------VLAMPLFDR-MGVDDPVGASAVHGVCGIWGVIAVGLFADNPIP 362
            .:|::|     ||         |...||.:: :.:.|..|...:|.:.|:.|.|...:.|  ...
Zfish   308 GSLIVG-----FCSGIVSTVGYVFLTPLMEKTLKIQDTCGVHNLHAMPGVIGGIVGAVTA--ACA 365

  Fly   363 LDTTNGRSGL-----FKG---------GGWYLLGIQTLSALCLACWGVCSTFLLLYVINKIIPIR 413
            .::..|..||     |:|         ||:...||....|..|....:....|.|       ||.
Zfish   366 SESVYGHEGLINMFGFEGKVNRTASVQGGYQAAGIFVAIAFGLVGGALVGGILKL-------PIW 423

  Fly   414 MDP 416
            .||
Zfish   424 GDP 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AmtNP_001097800.1 Ammonium_transp 30..428 CDD:275788 95/454 (21%)
rhcgl1NP_001103313.1 Ammonium_transp 43..420 CDD:275788 86/403 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D910733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.