DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amt and rhcga

DIOPT Version :8

Sequence 1:NP_001097800.1 Gene:Amt / 41841 FlyBaseID:FBgn0038309 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001083046.1 Gene:rhcga / 100038797 ZFINID:ZDB-GENE-070424-81 Length:489 Species:Danio rerio

Alignment Length:452 Identity:103/453 (23%)
Similarity:171/453 (38%) Gaps:106/453 (23%)


  Fly    21 YDLSVEDTNWV-------LTS-----------SF-----IIFTMQTGFGMLESGCVSIKNEVNIM 62
            ||:. .|.:|.       :||           ||     :||   .|||.|          :..:
Zfish    45 YDIE-SDAHWAEHKKHENITSDIENDFYFRYPSFQDVHVMIF---VGFGFL----------MTFL 95

  Fly    63 MKNVIDIVLGGFTYWLFGYGMSFGRGPLSNPFIAIGDF-LLDPPVGDALMGQIFAAFLFQLSFAT 126
            .:.....|  ||.:.:..:|:.:.       .:..|.| .|||..|...:|   ...|....|..
Zfish    96 KRYSFGAV--GFNFLVAAFGLQWA-------LLMQGWFHSLDPVDGTIKIG---VESLINADFCV 148

  Fly   127 TATTIVSGAMAERCNFKAYCLFSFLNTAVYCIPAGWVWGEHGFLNKLGAVDIAGSGPVHLIGGAS 191
            ....|..||:..:.:.....:.:.....:|.:.      |:..||.|...|..||..:|..|...
Zfish   149 AGCLIAYGALLGKVSPVQLMVMTLFGITLYAVE------EYIILNLLHVRDAGGSMVIHTFGAYY 207

  Fly   192 AFA-SAAMLGPRLGRYSEGYDPLPLGNPVNACMGLFVLWWGWLAFNSG-STYGVSGAKWQYAARA 254
            ... |..:..|:|.: ::..:.....:.|.|.:|...||..|.:|||. |.:|    ..|:  ||
Zfish   208 GLTISWILYRPKLDQ-AKHLNGSVYHSDVFAMIGTLFLWMFWPSFNSAISNHG----DGQH--RA 265

  Fly   255 AVMTMMGSFGGGFTS-SIYSFWRHGGGMDIMDLINGVL-GSLVSITAGCFLYRAWEALVIGAIGS 317
            |:.|.:.......|: :|.|.....|.:|::.:.|..| |.:...||..|:...:.:|::|    
Zfish   266 AINTYLSLAASVLTTFAISSMSAKKGKVDMVHIQNATLAGGVAMGTAAEFMISPYGSLIVG---- 326

  Fly   318 LFC---------VLAMPLFDR-MGVDDPVGASAVHGVCGIWGVIAVGLFADNPIPLDTTNGRSGL 372
             ||         |:..|..:: :.:.|..|...:|.:.|:.|.|...:.|....|  |..|:.||
Zfish   327 -FCCGIISTFGYVVITPFMEKYLKIQDTCGVHNLHAMPGLIGGIVGAITAAAASP--TVYGQEGL 388

  Fly   373 -----FKG----------GGWYLLGIQTLSALCLACWGVCSTFLLLYVINKIIPIRMDPHEE 419
                 |.|          ||:...||    |:.|| :|:....::..::.  :||..||.:|
Zfish   389 VNLFGFTGDYANRSSATQGGYQAAGI----AVALA-FGIVGGIIVGCILR--LPIWGDPSDE 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AmtNP_001097800.1 Ammonium_transp 30..428 CDD:275788 100/444 (23%)
rhcgaNP_001083046.1 Ammonium_transp 74..451 CDD:275788 97/423 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D910733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.