DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and SSA4

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_011029.3 Gene:SSA4 SGDID:S000000905 Length:642 Species:Saccharomyces cerevisiae

Alignment Length:651 Identity:480/652 (74%)
Similarity:545/652 (84%) Gaps:9/652 (1%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            |||  |||||||||||||..|.:.:|||||||||||||||||||||||||||||||||.||||..
Yeast     1 MSK--AVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPHN 63

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |:|||||||||||||..|.:|.||:||:|:...|||.::|.||.|.|||.|||||||:|||||||
Yeast    64 TVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSMILTKMKET 128

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            ||.:||..|.:||:||||||||||||||||||||||||||||||||||||||||||||:..|.||
Yeast   129 AENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNV 193

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            |||||||||||||:||||:|:||||:|||||||||||||:|||....:|||||:|||||||:|:|
Yeast   194 LIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSL 258

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAK 325
            ||||||.||||||||||.|.||||||||||.||||||||||||||.|||||||::||||.|.|:|
Yeast   259 RRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSK 323

  Fly   326 LDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQD 390
            ||||.|.:||||||||||||||:|:.|.|||||.|:|||||||||||||||||||.||:|...||
Yeast   324 LDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQD 388

  Fly   391 LLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455
            ||||||.|||||||||||:|:.||.||:|||||:::.|:||:||||||||||:||||..||||||
Yeast   389 LLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNL 453

  Fly   456 LGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVN 520
            |||||||||||||||||||||||||||||||||:|:|:.|.|.|||||||||||||||||::||.
Yeast   454 LGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVA 518

  Fly   521 EAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQ 585
            ||||::.|||::.:.:.|||.||||.|.:|.::.|:|.|.|:.:.|...:.....:.|.||||:|
Yeast   519 EAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQ 583

  Fly   586 LADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEV 650
            .|..|||:.||||||||.|||::|.|..||..||.     |.:|||  .||..||...|||:|||
Yeast   584 AASTEEYKERQKELEGVANPIMSKFYGAAGGAPGA-----GPVPGA--GAGPTGAPDNGPTVEEV 641

  Fly   651 D 651
            |
Yeast   642 D 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 461/611 (75%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 303/375 (81%)
SSA4NP_011029.3 PTZ00009 4..642 CDD:240227 476/645 (74%)
HSPA1-2_6-8-like_NBD 4..379 CDD:212675 303/375 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 944 1.000 Inparanoid score I36
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T133810
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.909 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R573
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.