DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and ECM10

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_010884.1 Gene:ECM10 SGDID:S000000756 Length:644 Species:Saccharomyces cerevisiae

Alignment Length:599 Identity:301/600 (50%)
Similarity:413/600 (69%) Gaps:28/600 (5%)


  Fly     2 SKAP--AVGIDLGTTYSCVGVFQHGKV-EIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62
            :|.|  .:|||||||.|.|.:.: ||| .||.|.:|:|||||.|||| |.|||:|:.||.|..:|
Yeast    23 TKIPDAVIGIDLGTTNSAVAIME-GKVPRIIENAEGSRTTPSVVAFTKDGERLVGEPAKRQSVIN 86

  Fly    63 PTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVS-ADGKPKIEVTYKDEKKTFFPEEISSMVLTK 126
            ...|:|..||||||:|:||.||.|:...||::|. ::|...:|.    ..:|:.|.:|...:|.|
Yeast    87 SENTLFATKRLIGRRFEDAEVQRDINQVPFKIVKHSNGDAWVEA----RNRTYSPAQIGGFILNK 147

  Fly   127 MKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVG 191
            |||||||||.|:|.|||:||||||||:|||||||||.|.||||||::|||||||:||||||..  
Yeast   148 MKETAEAYLAKSVKNAVVTVPAYFNDAQRQATKDAGQIIGLNVLRVVNEPTAAALAYGLDKSE-- 210

  Fly   192 ERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTN 256
            .:.:.:|||||||||:|||.||:||||||||.|||||||||||..|:...:..||::...||:.:
Yeast   211 PKVIAVFDLGGGTFDISILDIDNGIFEVKSTNGDTHLGGEDFDIYLLQEIISHFKKETGIDLSND 275

  Fly   257 KRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTD------FYTSITRARFEELNADLFRSTMD 315
            :.|::|:|.|.|:||..|||:  .|.||:..|...|      .....:|.:.|.:.|.|...|:|
Yeast   276 RMAVQRIREAAEKAKIELSST--LSTEINLPFITADAAGPKHIRMPFSRVQLENITAPLIDRTVD 338

  Fly   316 PVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAIL 380
            ||:|||:||::..|.|.|::||||.:|:|||...::.|| ||:.:|::|||||||.|||:|||:|
Yeast   339 PVKKALKDARITASDISDVLLVGGMSRMPKVADTVKKLF-GKDASKAVNPDEAVALGAAIQAAVL 402

  Fly   381 HGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEG 445
            .|    ||.|:||||||||||||||.|||.:.||.||:|||.|::|.|:|.:..|..|.::|::|
Yeast   403 SG----EVTDVLLLDVTPLSLGIETLGGVFTKLIPRNSTIPNKKSQIFSTAASGQTSVEVKVFQG 463

  Fly   446 ERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRL 510
            ||.:.|||.|:|.|.|:||||||:|.||||||||||||||:||:|.:.:::|::.||:....| |
Yeast   464 ERELVKDNKLIGNFTLAGIPPAPKGTPQIEVTFDIDANGIINVSAKDLASHKDSSITVAGASG-L 527

  Fly   511 SKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCN 575
            |..:|:|||||||:|:|:|..::..|...|..:....:.:.::.|  .:.|:..:|...:.|:.:
Yeast   528 SDTEIDRMVNEAERYKNQDRARRNAIETANKADQLANDTENSIKE--FEGKLDKTDSQRLKDQIS 590

  Fly   576 ETIKWLDANQLADK 589
            ...:.:..:|..|:
Yeast   591 SLRELVSRSQAGDE 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 301/600 (50%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 205/384 (53%)
ECM10NP_010884.1 HSPA9-like_NBD 28..402 CDD:212683 204/384 (53%)
dnaK 29..644 CDD:234715 299/594 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.