DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and SSE1

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_015219.1 Gene:SSE1 SGDID:S000006027 Length:693 Species:Saccharomyces cerevisiae

Alignment Length:657 Identity:189/658 (29%)
Similarity:312/658 (47%) Gaps:82/658 (12%)


  Fly     8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKR 72
            |:|||...|.:.|.::..::|:.|:..||:|||.|.|....|.:|:..||:...|...|:.:.||
Yeast     6 GLDLGNNNSVLAVARNRGIDIVVNEVSNRSTPSVVGFGPKNRYLGETGKNKQTSNIKNTVANLKR 70

  Fly    73 LIGRKFDDAAVQSDMKHWPFEVVSADGKPK-IEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLG 136
            :||..:.....:.:.||:..::|..|.|.. .||.:..||..|...::::|.:.|:|:|.:....
Yeast    71 IIGLDYHHPDFEQESKHFTSKLVELDDKKTGAEVRFAGEKHVFSATQLAAMFIDKVKDTVKQDTK 135

  Fly   137 KTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGE-----RNVL 196
            ..:|:..|.||.::.:.||....||..|||||.:||:|:.|||.::||:.|..:.|     |.|.
Yeast   136 ANITDVCIAVPPWYTEEQRYNIADAARIAGLNPVRIVNDVTAAGVSYGIFKTDLPEGEEKPRIVA 200

  Fly   197 IFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALR 261
            ..|:|..::..||::...|..:|..||.|.|.||.|||..:..||..|||.|:|.|:..|.:|..
Yeast   201 FVDIGHSSYTCSIMAFKKGQLKVLGTACDKHFGGRDFDLAITEHFADEFKTKYKIDIRENPKAYN 265

  Fly   262 RLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKL 326
            |:.||.|:.|:.||::|.|...::|:....|..:.::|...|||...|.....:||.|||..|||
Yeast   266 RILTAAEKLKKVLSANTNAPFSVESVMNDVDVSSQLSREELEELVKPLLERVTEPVTKALAQAKL 330

  Fly   327 DKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDL 391
            ....:..:.::||:||||.:::.:.:.| ||.|:.::|.|||:|.|||...|| | ..:..|:..
Yeast   331 SAEEVDFVEIIGGTTRIPTLKQSISEAF-GKPLSTTLNQDEAIAKGAAFICAI-H-SPTLRVRPF 392

  Fly   392 LLLDVTPLSLG--------------IETAGGVM--SVLIKRNTTIPTKQTQTFTTYSDNQPGVLI 440
            ...|:.|.|:.              :..||...  :.||..|.|.......::|..:...|....
Yeast   393 KFEDIHPYSVSYSWDKQVEDEDHMEVFPAGSSFPSTKLITLNRTGDFSMAASYTDITQLPPNTPE 457

  Fly   441 QVYEGERAMTKDNNLLGKFELSGI--PPAPRGVPQIEVTFDIDANGI------------------ 485
            |:              ..:|::|:  |.....|| :::....|.:|:                  
Yeast   458 QI--------------ANWEITGVQLPEGQDSVP-VKLKLRCDPSGLHTIEEAYTIEDIEVEEPI 507

  Fly   486 -LNVTALERSTNKENKITITNDKGRLSKEDI----------ERMVNEAEKYRNE----DEKQKET 535
             |...|.|.:..:..|:|.|     :.|:|:          .:.:||..:..||    |:...||
Yeast   508 PLPEDAPEDAEQEFKKVTKT-----VKKDDLTIVAHTFGLDAKKLNELIEKENEMLAQDKLVAET 567

  Fly   536 IAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWL-DANQLADKEEYEHRQKEL 599
            ...||.||.|.:.::..|:|: .....||:::|.:....|:..:|| |....:.|.:|..:.:||
Yeast   568 EDRKNTLEEYIYTLRGKLEEE-YAPFASDAEKTKLQGMLNKAEEWLYDEGFDSIKAKYIAKYEEL 631

  Fly   600 EGVCNPI 606
            ..:.|.|
Yeast   632 ASLGNII 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 189/658 (29%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 133/379 (35%)
SSE1NP_015219.1 HSP70 4..644 CDD:331774 189/658 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.