DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and SSB2

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_014190.1 Gene:SSB2 SGDID:S000005153 Length:613 Species:Saccharomyces cerevisiae

Alignment Length:606 Identity:367/607 (60%)
Similarity:460/607 (76%) Gaps:8/607 (1%)


  Fly     6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDA 70
            |:|||||||||||..:: ..||||||:||||.|||:||||..|||||||||||.|:||..|:|||
Yeast     9 AIGIDLGTTYSCVATYE-SSVEIIANEQGNRVTPSFVAFTPQERLIGDAAKNQAALNPRNTVFDA 72

  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            ||||||:|||.:||.|||.|||:|:..||.|.|||.|.:|.|||.|:|||:||||||||.|||.:
Yeast    73 KRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKI 137

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDK-KAVGERNVLIFD 199
            ||.|..|||||||||||:|||||||||.|:||||||||||||||||||||.. |:..||:|||||
Yeast   138 GKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFD 202

  Fly   200 LGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLR 264
            |||||||||:|.|..|::.||||:|:|||||:|||..|:.||..|||:|...|::.:.|||||||
Yeast   203 LGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISDDARALRRLR 267

  Fly   265 TACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKS 329
            ||.|||||||||.||.::|:||||:|.||.:|:||||||:|||.||:||::|||:.|:|||:.||
Yeast   268 TAAERAKRTLSSVTQTTVEVDSLFDGEDFESSLTRARFEDLNAALFKSTLEPVEQVLKDAKISKS 332

  Fly   330 VIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDK-SQEVQDLLL 393
            .|.::|||||||||||||:||.|.|:||:|.||||||||||||||||.|||.|.. |.|.:||||
Yeast   333 QIDEVVLVGGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLL 397

  Fly   394 LDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGK 458
            |||.|||||:...|.:..:::.||||:||.:.:||||.||||..|...||:|||...|:|.|||:
Yeast   398 LDVAPLSLGVGMQGDIFGIVVPRNTTVPTIKRRTFTTVSDNQTTVQFPVYQGERVNCKENTLLGE 462

  Fly   459 FELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAE 523
            |:|..||..|.|.|.:|..|::||||||.|||:|:||.|.:.|||:|..||||.|:||:|||:||
Yeast   463 FDLKNIPMMPAGEPVLEAIFEVDANGILKVTAVEKSTGKSSNITISNAVGRLSSEEIEKMVNQAE 527

  Fly   524 KYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLAD 588
            :::..||...:...|:..||||..:::.|:.:..|.:|:....::.|....::.   |.|.|:.|
Yeast   528 EFKAADEAFAKKHEARQRLESYVASIEQTVTDPVLSSKLKRGSKSKIEAALSDA---LAALQIED 589

  Fly   589 KEEYEHRQKELEGVCNPIITK 609
            ....|.|:.|: |: ..::||
Yeast   590 PSADELRKAEV-GL-KRVVTK 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 367/607 (60%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 267/376 (71%)
SSB2NP_014190.1 HSP70 9..608 CDD:278441 366/605 (60%)
HSPA1-2_6-8-like_NBD 9..384 CDD:212675 267/376 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281069187
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.790

Return to query results.
Submit another query.