DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and LHS1

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_012850.1 Gene:LHS1 SGDID:S000001556 Length:881 Species:Saccharomyces cerevisiae

Alignment Length:695 Identity:168/696 (24%)
Similarity:306/696 (44%) Gaps:105/696 (15%)


  Fly     2 SKAPAVGIDLG-TTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-----------TDTERLIGDA 54
            |.|..:|:|.| .....:.|.....:|::...:..|...|.::.           ...||:.|.|
Yeast    18 SLAAVLGVDYGQQNIKAIVVSPQAPLELVLTPEAKRKEISGLSIKRLPGYGKDDPNGIERIYGSA 82

  Fly    55 AKNQVAMNPTQTIFDAKRLIGRKFDDAAVQS--DMKHWPFEVVSADGKPKIEVTYKDEKKTFFPE 117
            ..:.....|..|:...|.|:|:..:|....:  ..:|...|:||.:   :..:.:..:...:..|
Yeast    83 VGSLATRFPQNTLLHLKPLLGKSLEDETTVTLYSKQHPGLEMVSTN---RSTIAFLVDNVEYPLE 144

  Fly   118 EISSMVLTKMKETAEAYL----GKT---VTNAVITVPAYFNDSQRQATKDAGTI-AGLNVLRIIN 174
            |:.:|.:.::...|.:.|    .:|   |.....|:|.:|:..||:|..||.:| .|:....:::
Yeast   145 ELVAMNVQEIANRANSLLKDRDARTEDFVNKMSFTIPDFFDQHQRKALLDASSITTGIEETYLVS 209

  Fly   175 EPTAAAIAYGLDKKAV--GE-RNVLIFDLGGGTFDVSILSI---DDG----IFEVKSTAGDTHLG 229
            |..:.|:.:.|.::..  || ::.:::|:|.|:...|:.||   :|.    ..|.:....:.|||
Yeast   210 EGMSVAVNFVLKQRQFPPGEQQHYIVYDMGSGSIKASMFSILQPEDTTQPVTIEFEGYGYNPHLG 274

  Fly   230 GEDFDNRLVTHFVQEFKRKH----KKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEG 290
            |..|...:.:....:|...|    ..:|..|.:||.::..|.|:||..||::::|||.|:||...
Yeast   275 GAKFTMDIGSLIENKFLETHPAIRTDELHANPKALAKINQAAEKAKLILSANSEASINIESLIND 339

  Fly   291 TDFYTSITRARFEELNADLFRSTMDPVEKALR------DAKLDKSVIHDIVLVGGSTRIPKVQRL 349
            .||.|||||..|||..||.....:.|:..|:.      ...|.:  |:.::|.|||:|||.||..
Yeast   340 IDFRTSITRQEFEEFIADSLLDIVKPINDAVTKQFGGYGTNLPE--INGVILAGGSSRIPIVQDQ 402

  Fly   350 LQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDK---SQEVQDLLLLD--VTPLSLGIETAGGV 409
            |..|.:.:::.:::|.||     :||...::.|.|   |.:.:.|.::|  |...|..:.....:
Yeast   403 LIKLVSEEKVLRNVNADE-----SAVNGVVMRGIKLSNSFKTKPLNVVDRSVNTYSFKLSNESEL 462

  Fly   410 MSVLIKRNTTIPTKQTQTFTTYSDNQP----------GVLIQVYEGERAMTKDNNLLGKFELSGI 464
            ..| ..|.:..|.| |...|..:|:.|          |.|.:.........|::....|.. ||:
Yeast   463 YDV-FTRGSAYPNK-TSILTNTTDSIPNNFTIDLFENGKLFETITVNSGAIKNSYSSDKCS-SGV 524

  Fly   465 PPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKI----TITNDKGRL--SKEDIE-RMVNEA 522
                    ...:|||:.::.:.::..:......||.|    .|.|...||  :.||:| :.::.:
Yeast   525 --------AYNITFDLSSDRLFSIQEVNCICQSENDIGNSKQIKNKGSRLAFTSEDVEIKRLSPS 581

  Fly   523 EKYRNE------DEKQKETIAAK---NGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETI 578
            |:.|..      |::.||....:   |.|||..::.:..|.:|    ::..:...:.:::.:|.:
Yeast   582 ERSRLHEHIKLLDKQDKERFQFQENLNVLESNLYDARNLLMDD----EVMQNGPKSQVEELSEMV 642

  Fly   579 K----WL-DANQLADKEEYEHRQKELEGVCNPIITKLYQGAGFPP 618
            |    || ||:...|.|:...|.:|: |:....| :||..:...|
Yeast   643 KVYLDWLEDASFDTDPEDIVSRIREI-GILKKKI-ELYMDSAKEP 685

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 167/688 (24%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 106/417 (25%)
LHS1NP_012850.1 DnaK 17..809 CDD:223520 168/696 (24%)
HYOU1-like_NBD 23..430 CDD:212672 106/417 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19375
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.