DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and SSA3

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_009478.1 Gene:SSA3 SGDID:S000000171 Length:649 Species:Saccharomyces cerevisiae

Alignment Length:653 Identity:483/654 (74%)
Similarity:553/654 (85%) Gaps:6/654 (1%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            ||:  |||||||||||||..|.:.:|||||||||||||||||||||||||||||||||.|:||..
Yeast     1 MSR--AVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAINPHN 63

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |:|||||||||||||..|.:|.||:||:|:|.||||.::|.||.|.|||.|||||||||:|||||
Yeast    64 TVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGETKTFTPEEISSMVLSKMKET 128

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            ||.|||.||.:||:||||||||||||||||||||||:|||||||||||||||||||||...|.||
Yeast   129 AENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNV 193

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            |||||||||||||:||||:|:||||:|||||||||||||||||.|...|||||.|||::.|:|:|
Yeast   194 LIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSL 258

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAK 325
            ||||||.|||||.||||:|.||||||||||.|||||:||||||||.|||||||::||||.|:|:|
Yeast   259 RRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSK 323

  Fly   326 LDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQD 390
            ||||.|.:||||||||||||:|:|:.|.|||||.|:|||||||||||||||||||.||:|.:.||
Yeast   324 LDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQD 388

  Fly   391 LLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455
            ||||||.|||||||||||:|:.||.||:|||||:::||:||:||||||||||:||||..||||||
Yeast   389 LLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNL 453

  Fly   456 LGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVN 520
            |||||||||||||||||||:|||||||||||||:|||:.|.|.||||||||||||||:||:|||:
Yeast   454 LGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVS 518

  Fly   521 EAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQ 585
            ||||||.:||::.|.:.|||.||||.|.:|.|::|.:.|.|:.:.|...:.....|||.||||:|
Yeast   519 EAEKYRADDEREAERVQAKNQLESYAFTLKNTINEASFKEKVGEDDAKRLETASQETIDWLDASQ 583

  Fly   586 LADKEEYEHRQKELEGVCNPIITKLY-QGAGFPPGGMPGGPGGMPGAAGAAGAAGAG-GAGPTIE 648
            .|..:||:.|||||||:.|||:||.| .|||..||.  |..||.||:...:||.|.| ..|||:|
Yeast   584 AASTDEYKDRQKELEGIANPIMTKFYGAGAGAGPGA--GESGGFPGSMPNSGATGGGEDTGPTVE 646

  Fly   649 EVD 651
            |||
Yeast   647 EVD 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 462/612 (75%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 301/375 (80%)
SSA3NP_009478.1 HSP70 4..649 CDD:331774 480/647 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 944 1.000 Inparanoid score I36
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T133810
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.830

Return to query results.
Submit another query.