DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and SSA1

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_009396.2 Gene:SSA1 SGDID:S000000004 Length:642 Species:Saccharomyces cerevisiae

Alignment Length:651 Identity:483/652 (74%)
Similarity:555/652 (85%) Gaps:9/652 (1%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            |||  |||||||||||||..|.:.:|:|||||||||||||:|||||||||||||||||.||||:.
Yeast     1 MSK--AVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSN 63

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |:|||||||||.|:|..||:||||:||:::..||||:|:|.:|.|.|.|.||:||||||.|||||
Yeast    64 TVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKET 128

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            ||:|||..|.:||:||||||||||||||||||||||||||||||||||||||||||||. .|.:|
Yeast   129 AESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKG-KEEHV 192

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            |||||||||||||:|||:|||||||:|||||||||||||||||.||:||||||:||||:||:|||
Yeast   193 LIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRAL 257

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAK 325
            |||||||||||||||||.|.|:||||||||.||||||||||||||.|||||||:|||||.|||||
Yeast   258 RRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAK 322

  Fly   326 LDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQD 390
            ||||.:.:||||||||||||||:|:.|.|||||.|:|||||||||||||||||||.||:|.:.||
Yeast   323 LDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQD 387

  Fly   391 LLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455
            ||||||.|||||||||||||:.||.||:|||||:::.|:||:||||||||||:|||||.||||||
Yeast   388 LLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDNNL 452

  Fly   456 LGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVN 520
            ||||||||||||||||||||||||:|:||||||:|:|:.|.|.||||||||||||||||||:||.
Yeast   453 LGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVA 517

  Fly   521 EAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQ 585
            ||||::.||||:.:.||:||.|||..:::|.|:.|..  .|:..:|:.|:..|..|||.|||:|.
Yeast   518 EAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAG--DKLEQADKDTVTKKAEETISWLDSNT 580

  Fly   586 LADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEV 650
            .|.|||::.:.|||:.:.|||::||||..|.|.|...|.|||.||.|..|..|    .|||:|||
Yeast   581 TASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEA----EGPTVEEV 641

  Fly   651 D 651
            |
Yeast   642 D 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 463/611 (76%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 306/375 (82%)
SSA1NP_009396.2 HSP70 4..642 CDD:331774 479/645 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 944 1.000 Inparanoid score I36
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T133810
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 LDO PTHR19375
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.830

Return to query results.
Submit another query.