DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and BIP3

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_172382.4 Gene:BIP3 AraportID:AT1G09080 Length:675 Species:Arabidopsis thaliana

Alignment Length:607 Identity:390/608 (64%)
Similarity:489/608 (80%) Gaps:2/608 (0%)


  Fly     7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAK 71
            :|||||||||||||:.:..|||||||||||.|||:|||||||||||:|||||.|.||.:||||.|
plant    53 IGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAAKNPERTIFDPK 117

  Fly    72 RLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLG 136
            |||||||||..||.|:|..|::||:.||||.|:|..|.|:|.|.|||||:|:||||||||||:||
plant   118 RLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVKGEEKLFSPEEISAMILTKMKETAEAFLG 182

  Fly   137 KTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLG 201
            |.:.:|||||||||||:|||||||||.||||||:|||||||.||||||||||. ||.|:|::|||
plant   183 KKIKDAVITVPAYFNDAQRQATKDAGAIAGLNVVRIINEPTGAAIAYGLDKKG-GESNILVYDLG 246

  Fly   202 GGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTA 266
            |||||||||:||:|:|||.||:|||||||||||:|::.:|::..|:|:.||::.:.:||.:||..
plant   247 GGTFDVSILTIDNGVFEVLSTSGDTHLGGEDFDHRVMDYFIKLVKKKYNKDISKDHKALGKLRRE 311

  Fly   267 CERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVI 331
            ||.|||:||:..|..:||:|||:|.||...:|||||||||.|||:.||:||:|||:||.|.||.|
plant   312 CELAKRSLSNQHQVRVEIESLFDGVDFSEPLTRARFEELNMDLFKKTMEPVKKALKDAGLKKSDI 376

  Fly   332 HDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDV 396
            .:||||||||||||||::|:|.|:|||.:|..|||||||||||||..:|.|:..:|.|::|||||
plant   377 DEIVLVGGSTRIPKVQQMLKDFFDGKEPSKGTNPDEAVAYGAAVQGGVLSGEGGEETQNILLLDV 441

  Fly   397 TPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL 461
            .||||||||.||||:.:|.|||.||||::|.||||.|.|..|.|.||||||:|||||..||||:|
plant   442 APLSLGIETVGGVMTNIIPRNTVIPTKKSQVFTTYQDQQTTVTINVYEGERSMTKDNRELGKFDL 506

  Fly   462 SGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYR 526
            :||.|||||||||||||::||||||.|.|.::.......||||||||||::|:||.|:.|||::.
plant   507 TGILPAPRGVPQIEVTFEVDANGILQVKAEDKVAKTSQSITITNDKGRLTEEEIEEMIREAEEFA 571

  Fly   527 NEDEKQKETIAAKNGLESYCFNMKATL-DEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKE 590
            .||:..||.|.|:|.||:|.:|||:|: |::.|..||||.|:..:.....|.::||:.|..|:||
plant   572 EEDKIMKEKIDARNKLETYVYNMKSTVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNAEKE 636

  Fly   591 EYEHRQKELEGVCNPIITKLYQ 612
            :|:.:.||:|.||:|:|..:|:
plant   637 DYDEKLKEVELVCDPVIKSVYE 658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 390/606 (64%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 260/374 (70%)
BIP3NP_172382.4 HSPA5-like_NBD 50..423 CDD:212681 259/371 (70%)
PTZ00009 53..658 CDD:240227 390/606 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.