DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and cpHsc70-2

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_199802.1 Gene:cpHsc70-2 AraportID:AT5G49910 Length:718 Species:Arabidopsis thaliana

Alignment Length:655 Identity:306/656 (47%)
Similarity:404/656 (62%) Gaps:37/656 (6%)


  Fly     7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPTQTIFDA 70
            ||||||||.|.|...:.||..|:.|.:|.|||||.||:|.: :||:|..||.|..:||..|.|..
plant    81 VGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSKDRLVGQIAKRQAVVNPENTFFSV 145

  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            ||.|||:.::.|.:|  |...:.|:. |....:::......|.|..||||:.||.|:.:.|..:|
plant   146 KRFIGRRMNEVAEES--KQVSYRVIK-DENGNVKLDCPAIGKQFAAEEISAQVLRKLVDDASRFL 207

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDL 200
            ...||.||||||||||||||.||||||.||||.|||||||||||::|||.::|:  ...:|:|||
plant   208 NDKVTKAVITVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFERKS--NETILVFDL 270

  Fly   201 GGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRT 265
            ||||||||:|.:.||:|||.||:|||||||:|||.|:|......||:....||..:|:||:||..
plant   271 GGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLASTFKKDEGIDLLKDKQALQRLTE 335

  Fly   266 ACERAKRTLSSSTQASIEIDSLFEGTD----FYTSITRARFEELNADLFRSTMDPVEKALRDAKL 326
            |.|:||..|||.||.::.:..:....|    ..|::||.:||||.:||......|||.:||||||
plant   336 AAEKAKIELSSLTQTNMSLPFITATADGPKHIETTLTRGKFEELCSDLLDRVRTPVENSLRDAKL 400

  Fly   327 DKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDL 391
            ....|.:::|||||||||.||.|::.| .|||.|.|:||||.||.||||||.:|.||    |.|:
plant   401 SFKDIDEVILVGGSTRIPAVQDLVRKL-TGKEPNVSVNPDEVVALGAAVQAGVLSGD----VSDI 460

  Fly   392 LLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLL 456
            :||||||||||:||.||||:.:|.||||:||.:::.|:|.:|.|..|.|.|.:|||...:||..:
plant   461 VLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSI 525

  Fly   457 GKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNE 521
            |.|.|.||||||||||||||.|||||||||:|:|.::.|.|:..||||. ...|.|::::.||.|
plant   526 GSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSASDKGTGKKQDITITG-ASTLPKDEVDTMVQE 589

  Fly   522 AEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQL 586
            ||::..||:::::.|..||..:|..:..:..|.|  |..||....:..:..|..|         |
plant   590 AERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKE--LGEKIPGPVKEKVEAKLQE---------L 643

  Fly   587 ADK------EEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGG--A 643
            .:|      :|.:.....|......|...||...  .|||....|||...::....::..||  .
plant   644 KEKIASGSTQEIKDTMAALNQEVMQIGQSLYNQP--QPGGADSPPGGEASSSSDTSSSAKGGDNG 706

  Fly   644 GPTIE 648
            |..|:
plant   707 GDVID 711

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 296/616 (48%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 196/379 (52%)
cpHsc70-2NP_199802.1 PLN03184 41..716 CDD:215618 306/656 (47%)
HSPA9-Ssq1-like_NBD 78..453 CDD:212676 195/378 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.