DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and MTHSC70-2

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_196521.1 Gene:MTHSC70-2 AraportID:AT5G09590 Length:682 Species:Arabidopsis thaliana

Alignment Length:658 Identity:318/659 (48%)
Similarity:424/659 (64%) Gaps:43/659 (7%)


  Fly     2 SKAPA----VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAM 61
            |..||    :|||||||.|||.|.:....::|.|.:|.|||||.||| |..|.|:|..||.|...
plant    51 SSKPAGNDVIGIDLGTTNSCVAVMEGKNPKVIENAEGARTTPSVVAFNTKGELLVGTPAKRQAVT 115

  Fly    62 NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTK 126
            |||.|:...||||||||||...|.:||..|:::|.|   |..:...:...:.:.|.:|.:.:|||
plant   116 NPTNTVSGTKRLIGRKFDDPQTQKEMKMVPYKIVRA---PNGDAWVEANGQQYSPSQIGAFILTK 177

  Fly   127 MKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVG 191
            |||||||||||:||.||:||||||||:|||||||||.||||:|.||||||||||::||:..|   
plant   178 MKETAEAYLGKSVTKAVVTVPAYFNDAQRQATKDAGRIAGLDVERIINEPTAAALSYGMTNK--- 239

  Fly   192 ERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTN 256
            |..:.:|||||||||||:|.|.:|:||||:|.|||.||||||||.|:...|.|||.....||..:
plant   240 EGLIAVFDLGGGTFDVSVLEISNGVFEVKATNGDTFLGGEDFDNALLDFLVNEFKTTEGIDLAKD 304

  Fly   257 KRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTD----FYTSITRARFEELNADLFRSTMDPV 317
            :.||:|||.|.|:||..|||::|..|.:..:.....    |..::||:|||.|...|...|.||.
plant   305 RLALQRLREAAEKAKIELSSTSQTEINLPFITADASGAKHFNITLTRSRFETLVNHLIERTRDPC 369

  Fly   318 EKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHG 382
            :..|:||.:....:.:::||||.||:||||.::.::| ||..:|.:|||||||.|||:|..||.|
plant   370 KNCLKDAGISAKEVDEVLLVGGMTRVPKVQSIVAEIF-GKSPSKGVNPDEAVAMGAALQGGILRG 433

  Fly   383 DKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGER 447
            |    |::|||||||||||||||.|||.:.||.||||||||::|.|:|.:|||..|.|:|.:|||
plant   434 D----VKELLLLDVTPLSLGIETLGGVFTRLITRNTTIPTKKSQVFSTAADNQTQVGIRVLQGER 494

  Fly   448 AMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSK 512
            .|..||.|||:|:|.||||:||||||||||||||||||:.|:|.:::|.|..:||| ...|.||:
plant   495 EMATDNKLLGEFDLVGIPPSPRGVPQIEVTFDIDANGIVTVSAKDKTTGKVQQITI-RSSGGLSE 558

  Fly   513 EDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE--DNLKTKISDSDRTTILDKCN 575
            :||::||.|||.:..:|:::||.|..||..::..::::.:|.|  :.:.::|:......:.| ..
plant   559 DDIQKMVREAELHAQKDKERKELIDTKNTADTTIYSIEKSLGEYREKIPSEIAKEIEDAVAD-LR 622

  Fly   576 ETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGA 640
            ......|.|::..|.|          ..|..::|:.:       .|.||.||  |:|...|:.|.
plant   623 SASSGDDLNEIKAKIE----------AANKAVSKIGE-------HMSGGSGG--GSAPGGGSEGG 668

  Fly   641 GGAGPTIE 648
            ....|..|
plant   669 SDQAPEAE 676

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 307/621 (49%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 199/384 (52%)
MTHSC70-2NP_196521.1 HSPA9-like_NBD 56..431 CDD:212683 197/382 (52%)
dnaK 59..682 CDD:234715 315/651 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.