DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and mtHsc70-1

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001328002.1 Gene:mtHsc70-1 AraportID:AT4G37910 Length:682 Species:Arabidopsis thaliana

Alignment Length:652 Identity:312/653 (48%)
Similarity:418/653 (64%) Gaps:55/653 (8%)


  Fly     7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPTQTIFDA 70
            :|||||||.|||.|.:.....:|.|.:|:|||||.||.... |.|:|..||.|...|||.|||.:
plant    55 IGIDLGTTNSCVSVMEGKTARVIENAEGSRTTPSVVAMNQKGELLVGTPAKRQAVTNPTNTIFGS 119

  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            ||||||:|||...|.:||..|:::|.|   |..:...:...:.|.|.:|.:.|||||||||||||
plant   120 KRLIGRRFDDPQTQKEMKMVPYKIVKA---PNGDAWVEANGQKFSPSQIGANVLTKMKETAEAYL 181

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDL 200
            ||::..||:||||||||:|||||||||.||||:|.||||||||||::||::.|   |..:.:|||
plant   182 GKSINKAVVTVPAYFNDAQRQATKDAGKIAGLDVQRIINEPTAAALSYGMNNK---EGVIAVFDL 243

  Fly   201 GGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRT 265
            ||||||||||.|..|:||||:|.|||.||||||||.|:.:.|.||||....|||.:..||:|||.
plant   244 GGGTFDVSILEISSGVFEVKATNGDTFLGGEDFDNTLLEYLVNEFKRSDNIDLTKDNLALQRLRE 308

  Fly   266 ACERAKRTLSSSTQASIEIDSLFEGTDFYT-----------SITRARFEELNADLFRSTMDPVEK 319
            |.|:||..|||:||..|.:       .|.|           ::||::||.|...|...|..|.:.
plant   309 AAEKAKIELSSTTQTEINL-------PFITADASGAKHLNITLTRSKFEGLVGKLIERTRSPCQN 366

  Fly   320 ALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDK 384
            .|:||.:....:.:::||||.||:||||.::.::| ||...|.:|||||||.|||:|..||.|| 
plant   367 CLKDAGVTIKEVDEVLLVGGMTRVPKVQEIVSEIF-GKSPCKGVNPDEAVAMGAAIQGGILRGD- 429

  Fly   385 SQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAM 449
               |:|||||||.||||||||.|.|.:.||.||||||||::|.|:|.:|||..|.|:|.:|||.|
plant   430 ---VKDLLLLDVVPLSLGIETLGAVFTKLIPRNTTIPTKKSQVFSTAADNQMQVGIKVLQGEREM 491

  Fly   450 TKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKED 514
            ..||.:||:|:|.||||||||:||||||||||||||..|:|.:::|.||..||| ...|.||.::
plant   492 AADNKVLGEFDLVGIPPAPRGMPQIEVTFDIDANGITTVSAKDKATGKEQNITI-RSSGGLSDDE 555

  Fly   515 IERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE--DNLKTKISDSDRTTILDKCNET 577
            |.|||.|||....:|:::|:.|..:|..::..::::.:|.|  :.:..:|:....|.:.|     
plant   556 INRMVKEAELNAQKDQEKKQLIDLRNSADTTIYSVEKSLSEYREKIPAEIASEIETAVSD----- 615

  Fly   578 IKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGG 642
            ::...|.     |:.|..:.::| ..|..::|:  |.....|.         |::|:.|::|.|.
plant   616 LRTAMAG-----EDVEDIKAKVE-AANKAVSKI--GEHMSKGS---------GSSGSDGSSGEGT 663

  Fly   643 AG 644
            :|
plant   664 SG 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 304/619 (49%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 200/386 (52%)
mtHsc70-1NP_001328002.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.