DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and AT3G09440

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001189847.1 Gene:AT3G09440 AraportID:AT3G09440 Length:649 Species:Arabidopsis thaliana

Alignment Length:654 Identity:478/655 (73%)
Similarity:553/655 (84%) Gaps:15/655 (2%)


  Fly     3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTI 67
            :.||:|||||||||||||:||.:|||||||||||||||||||||:||||||||||||||||..|:
plant     6 EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPINTV 70

  Fly    68 FDAKRLIGRKFDDAAVQSDMKHWPFEVVSADG-KPKIEVTYKDEKKTFFPEEISSMVLTKMKETA 131
            |||||||||:|.|::||||:|.|||.:.|... ||.|.|.||.|.|.|..||||||:|.||:|.|
plant    71 FDAKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEISSMILIKMREIA 135

  Fly   132 EAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKA--VGERN 194
            |||||.|:.|||:||||||||||||||||||.||||||:|||||||||||||||||||  |||:|
plant   136 EAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKN 200

  Fly   195 VLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRA 259
            ||||||||||||||:|:|::||||||:|||||||||||||||:|.|||||||||:|||::.|.||
plant   201 VLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRA 265

  Fly   260 LRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDA 324
            |||||||||||||||||:.|.:|||||||:|.|||..||||||||||.||||..|:||||.||||
plant   266 LRRLRTACERAKRTLSSTAQTTIEIDSLFDGIDFYAPITRARFEELNIDLFRKCMEPVEKCLRDA 330

  Fly   325 KLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ 389
            |:||:.|.|:|||||||||||||:||.|.||||||.||||||||||||||||||||.|:.:::||
plant   331 KMDKNSIDDVVLVGGSTRIPKVQQLLVDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQ 395

  Fly   390 DLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNN 454
            |||||||||||||:|||||||:|||:||||||||:.|.|:|||||||||||||||||||.|||||
plant   396 DLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNN 460

  Fly   455 LLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMV 519
            ||||||||||||||||||||.|.|||||||||||:|.:::|.::||||||||||||||::||:||
plant   461 LLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMV 525

  Fly   520 NEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDAN 584
            .|||||::|||:.|:.:.|||.||:|.:||:.|:.::.:..|::..|:..|.|.....|:||:||
plant   526 QEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEAN 590

  Fly   585 QLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGP--GGMPGAAGAAGAAGAGGAGPTI 647
            |||:.:|:|.:.||||.:|||||.|:||      ||..|||  |||....    ...||||||.|
plant   591 QLAECDEFEDKMKELESICNPIIAKMYQ------GGEAGGPAAGGMDEDV----PPSAGGAGPKI 645

  Fly   648 EEVD 651
            ||||
plant   646 EEVD 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 458/612 (75%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 302/378 (80%)
AT3G09440NP_001189847.1 PTZ00009 5..649 CDD:240227 477/653 (73%)
HSPA1-2_6-8-like_NBD 9..387 CDD:212675 302/378 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 950 1.000 Inparanoid score I49
OMA 1 1.010
OrthoDB 1 1.010 D288077at2759
OrthoInspector 1 1.000 T32203
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.909 Consistency score
87.980

Return to query results.
Submit another query.