DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and si:ch211-199o1.2

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001093532.1 Gene:si:ch211-199o1.2 ZFINID:ZDB-GENE-060503-867 Length:639 Species:Danio rerio

Alignment Length:653 Identity:525/654 (80%)
Similarity:576/654 (88%) Gaps:16/654 (2%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            |:|..::||||||||||||||||||||||||||||||||||||||||||||||||||||||||..
Zfish     1 MAKGLSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNN 65

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |||||||||||||||..||||||.|||:|:|.|||||::|.||.|.|||:|||||||||.||:|.
Zfish    66 TIFDAKRLIGRKFDDQVVQSDMKLWPFKVISEDGKPKVQVEYKGENKTFYPEEISSMVLVKMREI 130

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            ||||||..|.||||||||||||||||||||||.||||||||||||||||||||||||...|||||
Zfish   131 AEAYLGHRVNNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGRKGERNV 195

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            |||||||||||||||:|:|||||||:|||||||||||||||:|.|||:|||||||||::.||||:
Zfish   196 LIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVKHFVEEFKRKHKKDISQNKRAV 260

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAK 325
            |||||||||||||||||:||||||||||||.||||||||||||||||:|||.|:|||||||||||
Zfish   261 RRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSITRARFEELNAELFRGTLDPVEKALRDAK 325

  Fly   326 LDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQD 390
            :|||.|.|||||||||||||:|:||||.|||::||||||||||||||||||||||.||.|:.|||
Zfish   326 MDKSQIQDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSENVQD 390

  Fly   391 LLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455
            ||||||.|||||||||||||:.||||||||||||||.|:|||||||||||||:||||||||||||
Zfish   391 LLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFSTYSDNQPGVLIQVFEGERAMTKDNNL 455

  Fly   456 LGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVN 520
            ||||:|:||||||||||||||||||||||||||:|.::||.|||||||||||||||||||||||.
Zfish   456 LGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKENKITITNDKGRLSKEDIERMVQ 520

  Fly   521 EAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQ 585
            :||||:.|||.|:|.|||||.||||.|:||.|::::||:.|||:.|:..|:|||.|.:.||:.||
Zfish   521 DAEKYKAEDEVQREKIAAKNALESYAFSMKNTVEDENLRGKISEQDKKKIIDKCTEVVSWLENNQ 585

  Fly   586 LADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAG--AAGAGGAGPTIE 648
            ||:||||||.|||||.||||||::|||| |.||             ||..|  |......|||||
Zfish   586 LAEKEEYEHHQKELESVCNPIISRLYQG-GAPP-------------AGGCGFQAQPESSQGPTIE 636

  Fly   649 EVD 651
            |||
Zfish   637 EVD 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 508/611 (83%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 326/375 (87%)
si:ch211-199o1.2NP_001093532.1 HSP70 1..639 CDD:331774 524/652 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281045463
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T128641
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.