DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Ankrd45

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_082940.1 Gene:Ankrd45 MGIID:1921094 Length:282 Species:Mus musculus

Alignment Length:126 Identity:32/127 (25%)
Similarity:59/127 (46%) Gaps:29/127 (23%)


  Fly   508 GRLSKEDIERMVN-----EAEKYRNEDEKQKETIAAKNGLESYCFNM---------------KAT 552
            |||  |.::.:|.     ||..:|.  ||.::..|..:.:|  |.|.               |::
Mouse   154 GRL--ETLKALVELDVDIEALNFRG--EKARDVAARYSQVE--CVNFLDWADARLILKKIITKSS 212

  Fly   553 L---DEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKL 610
            |   |.:....|:...|::|||:.|....:||:::..|...|...::::||.:.:||:.|:
Mouse   213 LIITDPEKGPGKLFKEDKSTILNACRLKNEWLESHPEASISEIFEQKQQLEDIVSPILAKM 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 32/127 (25%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675
Ankrd45NP_082940.1 ANK 96..195 CDD:238125 14/47 (30%)
Ank_4 110..163 CDD:290365 4/11 (36%)
ANK repeat 110..140 CDD:293786
ANK repeat 142..173 CDD:293786 7/21 (33%)
Ank_4 143..195 CDD:290365 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.