DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hspa12b

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_082582.1 Gene:Hspa12b MGIID:1919880 Length:685 Species:Mus musculus

Alignment Length:668 Identity:132/669 (20%)
Similarity:225/669 (34%) Gaps:221/669 (33%)


  Fly     7 VGIDLGTTYSCVGVFQHGKVEII-------ANDQG--NRTTPSYVAFTDTERLIGDAAKNQVAMN 62
            |.||.|||.|..........|.|       ..|.|  ::.||:.:..|                 
Mouse    63 VAIDFGTTSSGYAFSFASDPEAIHMMRKWEGGDPGVAHQKTPTCLLLT----------------- 110

  Fly    63 PTQTIFDAKRLIGRKFDDAAVQSDMKHWPF------------------EVVSADGKPKIEVTYKD 109
             .:.||.:.....|.:.......:.:.|.:                  ::.:.:||..:.:....
Mouse   111 -PEGIFHSFGYTARDYYHDLDPEEARDWLYFEKFKMKIHSATDLTLKTQLEAVNGKKMLALEVFA 174

  Fly   110 EKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGL------N 168
            ....||.|.    .|.:::|.:|..|.|.....|:||||.:....:|..::|..:|||      .
Mouse   175 HALRFFKEH----ALQELREQSECMLEKGAVRWVLTVPAIWKQPAKQFMREAAYLAGLVSREDAE 235

  Fly   169 VLRIINEPTAAAI--------------AYGLDKKAVGER-------------------------- 193
            .|.|..||.||::              :....:..:|||                          
Mouse   236 KLLIALEPEAASVYCRKLRLHQLMDLSSRTAGRGRLGERRSIDSSFRHAREQLRRSRHSRTFLVE 300

  Fly   194 --------------NVLIFDLGGGTFDVSILSIDD--GIFE--VKSTAGDTHLGGED--FDNRLV 238
                          ..::.|.||||.|:::..::.  |..:  .|::.|.....|.|  |:..|.
Mouse   301 AGVGELWAEMQEGDRYMVADCGGGTVDLTVHQLEQPHGTLKELYKASGGPYGAVGVDLAFEQLLC 365

  Fly   239 THFVQEFKRKHKK-------DLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFY-- 294
            ..|.::|..|.|:       |||          .|.|..|||.......::.|...|...|||  
Mouse   366 RIFGEDFIAKFKRQRPAAWVDLT----------IAFEARKRTAGPHRAGALNISLPFSFIDFYRK 420

  Fly   295 -------TSITRARF---------------EELNADLFRST----MDPVEKALRDAKLDKSVIHD 333
                   |::.|:..               |.:| :||:.|    :..:|..|  ||.:...:..
Mouse   421 QRGHNVETALRRSSVNLVKWSSQGMLRMSCEAMN-ELFQPTVSGIIQHIEMLL--AKPEVQGVKL 482

  Fly   334 IVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTP 398
            :.||||......:|..:|:....:.|...:..|..:   ..::.|:|.|    :...::.:..:|
Mouse   483 LFLVGGFAESAVLQHAVQEALGTRGLRVVVPHDVGL---TILKGAVLFG----QAPGVVRVRRSP 540

  Fly   399 LSLGIETAGGVMS-----------VLIKRNTTIPTKQTQTFT--------------TYSDNQPG- 437
            |:.|:    ||::           :|::......|...:.|.              :|...:|| 
Mouse   541 LTYGV----GVLNRFVPGHHPPEKLLVRDGRRWCTDVFERFVAAEQSVALGEEVRRSYCPARPGQ 601

  Fly   438 --VLIQVY----EGERAMT-----KDNNLLGKFELSGIP------PAPRGVPQIEVTFDIDANGI 485
              |||.:|    |..|.:|     |...|..:.|..|.|      |:.|.:.......|.:    
Mouse   602 RRVLINLYCCAAEDARFITDPGVRKCGALSLELEPEGCPENTGTSPSRREIRAAMQFGDTE---- 662

  Fly   486 LNVTALERSTNKENKITI 503
            :.|||::.|||:..:..|
Mouse   663 IKVTAVDVSTNRSVRAAI 680

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 132/669 (20%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 98/502 (20%)
Hspa12bNP_082582.1 NBD_sugar-kinase_HSP70_actin 61..529 CDD:302596 99/508 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.