DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and LOC689955

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_008762842.1 Gene:LOC689955 RGDID:1586345 Length:646 Species:Rattus norvegicus

Alignment Length:654 Identity:553/655 (84%)
Similarity:599/655 (91%) Gaps:11/655 (2%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            |||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.
  Rat     1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTN 65

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |:|||||||||:||||.||||||||||.||:..|:||::|.||.|.|:|:|||:||||||||||.
  Rat    66 TVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEI 130

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            |||||||||||||:|:||||||||||||||||||||||||||||||||||||||||||...||||
  Rat   131 AEAYLGKTVTNAVVTMPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGXERNV 195

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            |||||||||||||||:|:|||||||||||||||||||||||:|.||:.|||||||||::.||||:
  Rat   196 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAV 260

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAK 325
            |||||||||||||||||||||||||||:||.||||||||||||||||||||.|:|||||||||||
  Rat   261 RRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAK 325

  Fly   326 LDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQD 390
            ||||.|||||||||||||||:|:||||.|||||||||||||||||||||||||||.||||:.|||
  Rat   326 LDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQD 390

  Fly   391 LLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455
            |||||||||||||||||.||:||||||||||||||||||||||||||||||||||||||||||||
  Rat   391 LLLLDVTPLSLGIETAGRVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455

  Fly   456 LGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVN 520
            ||||||:||||||||||||||||||||||||||:|:::||.|||||||||||||||||||||||.
  Rat   456 LGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQ 520

  Fly   521 EAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQ 585
            |||||:.|||||::.:::||.||||.||||||::::.|:.||:|.|:..|||||||.|.|||.||
  Rat   521 EAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQ 585

  Fly   586 LADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGG-PGGMPGAAGAAGAAGAGGA--GPTI 647
            .|:|||:||:|||||.|||||||||||.||..||||||| |||        ||..:|||  ||||
  Rat   586 TAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGG--------GAPPSGGASSGPTI 642

  Fly   648 EEVD 651
            ||||
  Rat   643 EEVD 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 527/611 (86%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 334/375 (89%)
LOC689955XP_008762842.1 PTZ00009 1..613 CDD:240227 528/612 (86%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 334/375 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.