DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and HSPA13

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_008879.3 Gene:HSPA13 HGNCID:11375 Length:471 Species:Homo sapiens

Alignment Length:430 Identity:168/431 (39%)
Similarity:251/431 (58%) Gaps:50/431 (12%)


  Fly     7 VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFD 69
            :||||||||..||||  ..|||::|.::.|:.:.||.|:|||.:..:|..:......||..||:|
Human    34 IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGYESVELADSNPQNTIYD 98

  Fly    70 AKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAY 134
            |||.||:.|....:::::..:||:|::.:|..:..|| .:|..|..||.:.|.:|.|:||.||||
Human    99 AKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSPEYVGSRLLLKLKEMAEAY 162

  Fly   135 LGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFD 199
            ||..|.||||:|||.|:..||.:|.:|..:|||.:||:||||||||:||||.|..|  .:||:.|
Human   163 LGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVID 225

  Fly   200 LGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLR 264
            |||||.|||:|:...|:|..::.:|:..|||:||:.||:.:..::..:.: ..:.:.|..:.|||
Human   226 LGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTY-GFVPSRKEEIHRLR 289

  Fly   265 TACERAK--RTLSSSTQASIEI-------------------DSLFEGTD---------------- 292
            .|.|..|  .||..|.|.|:.:                   |.|....|                
Human   290 QAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKS 354

  Fly   293 ------FYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQ 351
                  |.|.|:|..|:.||.|||:..:.|:::.|::..|:|:.|.::||||||||||::::::|
Human   355 GESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQ 419

  Fly   352 DLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDL 391
            :.| ||:.|.|::||.||..|.|:||.|..|....:|..|
Human   420 EFF-GKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSAL 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 168/431 (39%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 165/419 (39%)
HSPA13NP_008879.3 HSPA13-like_NBD 12..463 CDD:212679 168/431 (39%)
PRK13930 32..442 CDD:237564 162/413 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.