DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hspa2

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_068635.1 Gene:Hspa2 RGDID:620664 Length:633 Species:Rattus norvegicus

Alignment Length:652 Identity:524/653 (80%)
Similarity:575/653 (88%) Gaps:23/653 (4%)


  Fly     2 SKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQT 66
            ::.||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|
  Rat     3 ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNT 67

  Fly    67 IFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETA 131
            ||||||||||||:||.||||||||||.|||..||||::|.||.|.||||||||||||||||||.|
  Rat    68 IFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIA 132

  Fly   132 EAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK--AVGERN 194
            |||||..|.:|||||||||||||||||||||||.|||||||||||||||||||||||  |.||:|
  Rat   133 EAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKN 197

  Fly   195 VLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRA 259
            ||||||||||||||||:|:|||||||||||||||||||||||:|:|..:|||||||||:..||||
  Rat   198 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRA 262

  Fly   260 LRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDA 324
            :|||||||||||||||||||||||||||:||.||||||||||||||||||||.|::|||||||||
  Rat   263 VRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDA 327

  Fly   325 KLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ 389
            ||||..|.:||||||||||||:|:||||.|||||||||||||||||||||||||||.||||:.||
  Rat   328 KLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQ 392

  Fly   390 DLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNN 454
            |||||||||||||||||||||:.|||||||||||||||||||||||..||:||||||||||||||
  Rat   393 DLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNN 457

  Fly   455 LLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMV 519
            |||||:|:||||||||||||||||||||||||||||.::||.||||||||||||||||:||:|||
  Rat   458 LLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMV 522

  Fly   520 NEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDAN 584
            .||:.|::|||..::.:||||.:|||.:|:|.|::::.|:.|||:.|:..|||||.|.|.|||.|
  Rat   523 QEADGYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRN 587

  Fly   585 QLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEE 649
            |:|:|:||||:|||||.||||||:||||          |||||           |....||||||
  Rat   588 QMAEKDEYEHKQKELERVCNPIISKLYQ----------GGPGG-----------GGSSGGPTIEE 631

  Fly   650 VD 651
            ||
  Rat   632 VD 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 509/612 (83%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 332/377 (88%)
Hspa2NP_068635.1 PTZ00009 2..615 CDD:240227 509/612 (83%)
Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 2..389 337/386 (87%)
HSPA1-2_6-8-like_NBD 7..383 CDD:212675 331/376 (88%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 397..512 104/115 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281045113
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.