DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa8

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001103873.1 Gene:hspa8 ZFINID:ZDB-GENE-990415-92 Length:649 Species:Danio rerio

Alignment Length:652 Identity:551/653 (84%)
Similarity:601/653 (92%) Gaps:4/653 (1%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            |||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.
Zfish     1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTN 65

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |:|||||||||:|||..||||||||||.|::.:.:||::|.||.|.|:|:||||||||||||||.
Zfish    66 TVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEI 130

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            |||||||||:||||||||||||||||||||||||:|||||||||||||||||||||||...||||
Zfish   131 AEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNV 195

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            |||||||||||||||:|:|||||||||||||||||||||||:|.||:.|||||||||::.||||:
Zfish   196 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAV 260

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAK 325
            |||||||||||||||||||||||||||:||.||||||||||||||||||||.|:|||||||||||
Zfish   261 RRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAK 325

  Fly   326 LDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQD 390
            :||:.|||||||||||||||:|:||||.|||||||||||||||||||||||||||.||||:.|||
Zfish   326 MDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQD 390

  Fly   391 LLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455
            ||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||||
Zfish   391 LLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455

  Fly   456 LGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVN 520
            ||||||:|||||||||||||||||||||||:||:|:::||.|||||||||||||||||||||||.
Zfish   456 LGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQ 520

  Fly   521 EAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQ 585
            |||||:.||:.|::.::||||||||.||||:|::::.||.||||.|:..|||||||.|.|||.||
Zfish   521 EAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQ 585

  Fly   586 LADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGG-PGGMPGAAGAAGAAGAGGAGPTIEE 649
            .|::||:||:|||||.|||||||||||.||..|||||.| |||.|| |||  |.|.|.:||||||
Zfish   586 TAEREEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPEGMPGGFPG-AGA--APGGGSSGPTIEE 647

  Fly   650 VD 651
            ||
Zfish   648 VD 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 523/611 (86%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 330/375 (88%)
hspa8NP_001103873.1 HSP70 1..614 CDD:331774 524/613 (85%)
Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 2..386 337/384 (88%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 394..509 107/115 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1097 1.000 Inparanoid score I215
OMA 1 1.010
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T128641
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.941 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R573
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.