DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa14

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001038541.1 Gene:hspa14 ZFINID:ZDB-GENE-041210-73 Length:504 Species:Danio rerio

Alignment Length:513 Identity:180/514 (35%)
Similarity:299/514 (58%) Gaps:33/514 (6%)


  Fly     6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDA 70
            |:|:..|.|.:||.||:.|:.:::|||.|:|.||:.||:.|||:::|.|||.....|...|:...
Zfish     3 AIGVHFGYTCACVAVFKDGRADVVANDAGDRVTPAVVAYRDTEQIVGIAAKQGRIRNAANTVVKV 67

  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            |:::||::||...|:..:.....||:..|.|:.|:...:..|...||:::.::..||||||::.|
Zfish    68 KQILGRRYDDPDAQAHKEESKCIVVNKSGLPRYEIDTGETTKYVSPEDVAKLIFHKMKETAQSAL 132

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKA-VGERNVLIFD 199
            |..|.:||||||..|::.|:.|.:.|...||.||||:|:||:||.:||.:.:.: :|:.:||::.
Zfish   133 GSDVKDAVITVPFEFDEMQKNALRQAAESAGFNVLRLIHEPSAALLAYDIGQDSPLGKSHVLVYK 197

  Fly   200 LGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLR 264
            |||.:..|::|.::.|::.|.:|..|...|||.|...|..|...|||:..|:|::.|.||:.:|.
Zfish   198 LGGTSLSVTVLEVNSGVYRVLATQTDHQTGGESFTQELAQHLAAEFKKTFKQDVSGNARAMMKLM 262

  Fly   265 TACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKS 329
            .:.:.||.|||:...|:..:|||::|.||..:::|||||.:.:.||...:.|::..|....|..|
Zfish   263 NSADVAKHTLSTLGSANCFVDSLYDGMDFECNVSRARFELICSSLFNKCIQPIKSLLEQVNLSTS 327

  Fly   330 VIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEV-QDLLL 393
            .::.:||.|||.||||:|::::|||...||..||.|||.:..|||:||.||.|..|..: :|.:.
Zfish   328 DVNKVVLSGGSARIPKLQQMIRDLFPDVELLNSIPPDEVIPVGAAMQAGILVGKDSLALGEDSIT 392

  Fly   394 LD--VTPLSL------GIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPG----VLIQVYEGE 446
            :|  .:.::|      |:|    |.:||....|.:|.::..|.     ..||    |.:|:::.:
Zfish   393 VDCCASDITLKEVDDSGLE----VFTVLFPSGTPLPARRQHTL-----QGPGSLSSVRLQLFQAQ 448

  Fly   447 RAMTKDNNLLGKFELSGIPPAPR-GVPQIEVTFDIDANGILNVTALERSTNKENKITI 503
            :.:.:  .:||..|       |: .:..:.....:..:|.|:||..|:|:.:...|||
Zfish   449 QPIAQ--IVLGDLE-------PKEELHDVVTVLTMKRDGSLHVTCTEQSSGRSEAITI 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 180/514 (35%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 150/376 (40%)
hspa14NP_001038541.1 HSPA14-like_NBD 2..376 CDD:212680 148/373 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.