DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hsp70l

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001107061.1 Gene:hsp70l ZFINID:ZDB-GENE-050321-1 Length:643 Species:Danio rerio

Alignment Length:649 Identity:523/650 (80%)
Similarity:576/650 (89%) Gaps:10/650 (2%)


  Fly     3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTI 67
            |..|:||||||||||||||||||||||||||||||||||||||||||||||||||||||||..|:
Zfish     5 KGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTV 69

  Fly    68 FDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAE 132
            |||||||||:|||..||||||||.|:|||..||||:.|.:|.|.|||.|||||||||.||||.||
Zfish    70 FDAKRLIGRRFDDPVVQSDMKHWSFKVVSDGGKPKVAVEHKGENKTFNPEEISSMVLVKMKEIAE 134

  Fly   133 AYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLI 197
            ||||:.|||||||||||||||||:||||||.||||||||||||||||||||||||....||||||
Zfish   135 AYLGQKVTNAVITVPAYFNDSQRRATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKSSERNVLI 199

  Fly   198 FDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRR 262
            |||||||||||||:|:|||||||:|||||||||||||||:|.|||:|||||||||::.|||||||
Zfish   200 FDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRR 264

  Fly   263 LRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLD 327
            |||||||||||||.|:|||||||||:||.||||||||||||||.:||||.|:|||||||||||:|
Zfish   265 LRTACERAKRTLSPSSQASIEIDSLYEGIDFYTSITRARFEELCSDLFRGTLDPVEKALRDAKMD 329

  Fly   328 KSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLL 392
            |:.|||||||||||||||:|:||||.|||:|||||||||||||||||||||||.||.|..|||||
Zfish   330 KAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLL 394

  Fly   393 LLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLG 457
            ||||.|||||||||||||:.||||||||||||||||||||||||||||||:||||||||||||||
Zfish   395 LLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLG 459

  Fly   458 KFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEA 522
            ||||:||||||||||||||||||||||||||:|.::||.|:|:|||||||||||||:|||||.||
Zfish   460 KFELTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKQNRITITNDKGRLSKEEIERMVQEA 524

  Fly   523 EKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLA 587
            :||:.||:.|:|.|:|||.||||.||||.::::||||.|||:.|:..:::||||.:.||:.||||
Zfish   525 DKYKAEDDLQREKISAKNSLESYAFNMKNSVEDDNLKGKISEEDKKRVVEKCNEAVSWLENNQLA 589

  Fly   588 DKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEVD 651
            |||||||:.||||.||||:|:||||      ||||.|..|    |.|..|:||...||||||||
Zfish   590 DKEEYEHQLKELEKVCNPVISKLYQ------GGMPAGGCG----AQARAASGASAQGPTIEEVD 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 503/609 (83%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 323/375 (86%)
hsp70lNP_001107061.1 PTZ00009 5..643 CDD:240227 522/648 (81%)
HSPA1-2_6-8-like_NBD 8..383 CDD:212675 323/375 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281055812
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.