DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and si:ch211-250m6.2

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_003198604.1 Gene:si:ch211-250m6.2 ZFINID:ZDB-GENE-061009-20 Length:571 Species:Danio rerio

Alignment Length:607 Identity:125/608 (21%)
Similarity:230/608 (38%) Gaps:175/608 (29%)


  Fly     7 VGIDLGTTYSCVGVF----QHGKVEIIAN---DQGNRT--TPSYVAFTDTE--RLIGDAAKNQVA 60
            :.||.||:||...:.    |..:..:|.|   |.|..|  ||:.:.|.:.|  :..|        
Zfish     8 IAIDFGTSYSGYAISFKTKQPQESILIPNWGVDYGYNTFKTPTCILFDEHETFQKFG-------- 64

  Fly    61 MNPTQTIFDAKRLIGRKFDDAAVQSD------MKHWPFEVVSADGKPKIEVTYKD----EKKTFF 115
                   :||.....|    :.|:|.      .:|:..|:...:....:.:|.|:    :..|.|
Zfish    65 -------YDAMMTYTR----STVKSQARKSFLFEHFKMELYDKEIHRDLMITAKNGGQMKALTVF 118

  Fly   116 PEEISSM---VLTKMKE--TAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNV------ 169
            .|.:..:   .|.|:||  |.:.::...|| .|:||||.:|.:.:|..::|...|||.:      
Zfish   119 SESLRYLKDHALEKVKENPTGKTFIASDVT-WVLTVPAIWNAAAKQFMREAAIEAGLVIESEPER 182

  Fly   170 LRIINEPTAAAI--------AYGLDKKAVGE-------RNVLIFDLGGGTFDVSILS-IDDGIFE 218
            |....||.||:|        .| :.::|..:       ...::.|.||||.|:::.. ::||..:
Zfish   183 LVFALEPEAASIYCKHLPSEGY-ISEEACRDTLEQKPGTQYMVVDCGGGTIDITVHEVVEDGKLK 246

  Fly   219 VKSTAGDTHLGGEDFDNRLVTH----FVQEFKRKHKKDLTTNKRALR---RLRTACE-----RAK 271
            ..:.|....:||:..|.:.::.    |.::...|.::|.......|:   .|..:|:     :..
Zfish   247 ELNAASGNDMGGQTVDRKFISFLKEIFSEKIYNKFEQDFPAEALKLKYDIALAKSCDQLVLIQCP 311

  Fly   272 RTLSSSTQASIEIDSLFEGT------DFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSV 330
            .||....:....|:|.|||.      :....|...:.:....:..::|.:.:||...:.:|:   
Zfish   312 VTLQELAKKEKAIESYFEGVEGAEWDEGSIIIKEDKLQSFFDESLKTTAEKLEKITSNPELN--- 373

  Fly   331 IHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPD---------------------EAVAYGAA 374
            |..::||||......:::.|::.|:..::...:.|.                     .|:.||..
Zfish   374 IEYMLLVGGFAECKILKKFLKERFDKCKIVCPVEPQVVIIKGAIRYAKQPKVVKSRMSALTYGIR 438

  Fly   375 VQA---AILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTI-----------PTKQT 425
            :.|   .:||.|||..|.          |.|...........:::..::           |:...
Zfish   439 IDAPFDKVLHKDKSNYVN----------SEGQTYCDVCFETFVRKGESVNCDEVRQFFFNPSHTN 493

  Fly   426 QT---FTTYSDN--------QPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVP---QIEV 476
            ||   |..:|.|        :|||               ..:|.||: |:|....|:.   ::|:
Zfish   494 QTSAIFQFFSTNEKQVQFIDEPGV---------------EPVGFFEV-GMPKTDGGLSREIKLEI 542

  Fly   477 TF----------DIDANGILNV 488
            .|          |:|:....:|
Zfish   543 KFGSTEMKATATDVDSGETTSV 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 125/608 (21%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 98/464 (21%)
si:ch211-250m6.2XP_003198604.1 HSPA12_like_NBD 6..420 CDD:212671 93/436 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.