DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and si:dkey-61p9.6

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001038346.3 Gene:si:dkey-61p9.6 ZFINID:ZDB-GENE-030131-8896 Length:571 Species:Danio rerio

Alignment Length:603 Identity:120/604 (20%)
Similarity:228/604 (38%) Gaps:167/604 (28%)


  Fly     7 VGIDLGTTYSCVGVF----QHGKVEIIAN---DQGNRT--TPSYVAFTDTE--RLIGDAAKNQVA 60
            :.||.||:||...:.    |..:...|.|   :.|..|  ||:.:.|.:.|  :..|        
Zfish     8 IAIDFGTSYSGYAISFKTKQPQESIQIPNWGVNFGYNTFKTPTCILFDEHETFQKFG-------- 64

  Fly    61 MNPTQTIFDAKRLIGRKFDDAAVQSD--MKHWPFEVVSADGKPKIEVTYKD----EKKTFFPEEI 119
                   :||.....|....:..:..  .:|:..|:...:....:.:|.|:    :..|.|.|.:
Zfish    65 -------YDAMMTYTRSTPKSQARKSFLFEHFKMELYDKEIHRDLMITAKNGGQMKALTVFSESL 122

  Fly   120 SSM---VLTKMKE--TAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNV------LRII 173
            ..:   .|.|:||  |.:.::...|| .|:||||.:|.:.:|..::|...|||.:      |...
Zfish   123 RYLKDHALEKIKENTTGKTFIASDVT-WVLTVPAIWNAAAKQFMREAAIEAGLVIESEPERLVFA 186

  Fly   174 NEPTAAAI--------AYGLDKKAVGE-------RNVLIFDLGGGTFDVSILS-IDDGIFEVKST 222
            .||.||:|        .| :.::|..:       ...::.|.||||.|:::.. ::||..:..:.
Zfish   187 LEPEAASIYCKQLPSEGY-ISEEACRDTLEQKPGTQYMVVDCGGGTIDITVHEVVEDGKLKELNA 250

  Fly   223 AGDTHLGGEDFDNRLVTH----FVQEFKRKHKKDLTTNKRALR---RLRTACE-----RAKRTLS 275
            |....:||:..|.:.::.    |.::...|.::|.......|:   .|..:|:     :...||.
Zfish   251 ASGNDMGGQTVDRKFISFLKEIFSEKIYNKFEQDFPAEALKLKYDIALAKSCDQLVLIQCPVTLQ 315

  Fly   276 SSTQASIEIDSLFEGT------DFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDI 334
            ...:....|:|.|||.      :....|...:.:....:..::|.:.:||.:.:.:|:   |..:
Zfish   316 DLAKKEKAIESYFEGVEGAEWDEGSIIIKEDKLQSFFDESLKTTAEKLEKIMSNPELN---IEYM 377

  Fly   335 VLVGGSTRIPKVQRLLQDLFNGKELNKSINPD---------------------EAVAYGAAVQA- 377
            :||||......:::.|::.|:..::...:.|.                     .|:.||..:.| 
Zfish   378 LLVGGFAECKILKKFLKERFDKCKIVCPVEPQVVIIKGAIRYAKQPKVVKSRMSALTYGIRIDAP 442

  Fly   378 --AILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTI-----------PTKQTQTFT 429
              .:||..|:..|.          |.|...........:::..::           |:...|||.
Zfish   443 FDKVLHKGKTSYVN----------SEGQTYCDVCFETFVRKGESVNCDEVRQFFFNPSDTNQTFA 497

  Fly   430 T---YSDN--------QPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVP---QIEVTF-- 478
            |   :|.|        :|||               ..:|.|:: |:|....|:.   ::|:.|  
Zfish   498 TFQFFSTNEKQVQFIDEPGV---------------ESVGVFQV-GMPKTDGGLSREIKLEIKFGS 546

  Fly   479 --------DIDANGILNV 488
                    |:|:....:|
Zfish   547 TEMKATATDVDSGETTSV 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 120/604 (20%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 95/460 (21%)
si:dkey-61p9.6NP_001038346.3 HSPA12_like_NBD 6..420 CDD:212671 90/432 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.