DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and ankrd45

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001018606.1 Gene:ankrd45 ZFINID:ZDB-GENE-050522-311 Length:224 Species:Danio rerio

Alignment Length:99 Identity:24/100 (24%)
Similarity:54/100 (54%) Gaps:6/100 (6%)


  Fly   516 ERMVNEAEKYRNEDEKQKETIA---AKNGLESYCFNMKATL-DEDNLKTKISDSDRTTILDKCNE 576
            |:.|:.|.:|...|  ..|.:|   ||..|:::...::|.: |::.::.|::..|:...::.|:.
Zfish   115 EKAVDVARRYDKLD--CAEYLAWAEAKQNLQAFIQEVRAIVADQEKVQGKLNKEDKNICINTCSA 177

  Fly   577 TIKWLDANQLADKEEYEHRQKELEGVCNPIITKL 610
            ..:|::..:.|..:.:..::|.||.|..|::.||
Zfish   178 KSEWINNTRTATAQVFIEQKKLLEDVLAPVLLKL 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 24/100 (24%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675
ankrd45NP_001018606.1 ANK <42..133 CDD:238125 6/20 (30%)
ANK repeat 46..78 CDD:293786
Ank_2 51..143 CDD:289560 10/30 (33%)
ANK repeat 80..111 CDD:293786
ANK repeat 113..143 CDD:293786 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.