DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa13

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001017223.1 Gene:hspa13 XenbaseID:XB-GENE-963595 Length:476 Species:Xenopus tropicalis

Alignment Length:426 Identity:168/427 (39%)
Similarity:243/427 (57%) Gaps:55/427 (13%)


  Fly     7 VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFD 69
            :||||||||..||||.  .|:|.:|.::.|:::.||.|:||:.:..:|.........||..||:|
 Frog    34 IGIDLGTTYCSVGVFHPGTGEVRVITDENGHQSIPSIVSFTEKDVFVGYDGLELADANPQNTIYD 98

  Fly    70 AKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAY 134
            |||.||:.|....::.:...:.|:|::.:|.....|: .:|.....||.|||.:|.|:|:.||.|
 Frog    99 AKRFIGKIFTQEELEKESVRYQFKVLNRNGDVFFSVS-TNETFAVTPEYISSQLLLKLKKMAEDY 162

  Fly   135 LGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFD 199
            ||..|:.|||:|||.|::.||..|..|..:|||::||:||||||||:||||.|  |...|||:.|
 Frog   163 LGLPVSKAVISVPAEFDERQRNYTVKAANLAGLDILRVINEPTAAAMAYGLHK--VDVFNVLVVD 225

  Fly   200 LGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLR 264
            |||||.|||:|:...|:|..::.||:..|||:||:.||:.:...:...:: ..:.:.|..:.|||
 Frog   226 LGGGTLDVSLLNKQGGMFLTRAMAGNNKLGGQDFNQRLLQYLYDKIYTRY-GSVPSQKEEIHRLR 289

  Fly   265 TACERAKRTL---SSS------TQASIEIDS----------LFEGT-----------DFYTS--- 296
            .|.|..|..|   :||      |.||...||          ..|.|           |.|:|   
 Frog   290 QAVEAIKLNLTLHNSSWVRMPLTLASTHPDSSKPDKIIPNESLENTGEIHPKSAHLGDSYSSSGP 354

  Fly   297 ---------------ITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKV 346
                           |||..||.||.|||:..:.|||:.|::..:.|..:.:|||||||||||::
 Frog   355 QIQNKHAEKVYFEMEITRHIFETLNEDLFQKILIPVEQVLKEGHVLKEEVDEIVLVGGSTRIPRI 419

  Fly   347 QRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHG 382
            :::::|.| ||:.|.|::||.||..|.|:||.|:.|
 Frog   420 RQVIRDFF-GKDPNTSVDPDLAVVTGVAIQAGIMGG 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 168/427 (39%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 167/424 (39%)
hspa13NP_001017223.1 HSPA13-like_NBD 23..468 CDD:212679 168/427 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.