DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa14

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001015780.1 Gene:hspa14 XenbaseID:XB-GENE-5932856 Length:508 Species:Xenopus tropicalis

Alignment Length:509 Identity:170/510 (33%)
Similarity:291/510 (57%) Gaps:18/510 (4%)


  Fly     6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDA 70
            |:|:.||.|.:||.|::.|:.:::|||.|:|.||:.|.|.:.|.::|.|||.....|.|.||...
 Frog     3 AIGVHLGCTCACVAVYKDGRADVVANDAGDRVTPAVVGFLEKETIVGLAAKQSRVRNATNTIVKV 67

  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            |:::||.:.|...|..:......||...||||.|:...:.:|....|:::.::.:||||||::.|
 Frog    68 KQILGRSYGDPHTQKHISESKCIVVEKVGKPKYEIDTGETQKFVSSEDVAKLIFSKMKETAQSAL 132

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKA-VGERNVLIFD 199
            |..|.:.|||||..|.:||::|..:|.|.||.::||:|:||:||.:|||:.::: .|:.|||::.
 Frog   133 GSDVNDVVITVPFDFGESQKKALGEAATAAGFSILRMIHEPSAALLAYGIGQESPTGKSNVLVYK 197

  Fly   200 LGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLR 264
            |||.:..|:::.::.||:.|.:|:....:||..|...|..|...||:|.:|:|:..|.||:.:|.
 Frog   198 LGGTSLSVTVIEVNSGIYRVLATSTYDDIGGICFTEALAQHLASEFQRTYKQDIRGNARAMMKLM 262

  Fly   265 TACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKS 329
            .:.:.||..||:...::..:|||::|.||..:::|||||.:.:.||...:||::|.|.......:
 Frog   263 NSADVAKHALSTLGSSNCFVDSLYDGIDFDCNVSRARFELICSSLFNQCIDPIKKLLEQIGFKAN 327

  Fly   330 VIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ-DLLL 393
            .::.:||.|||.||||:|:|::|||...|:..||.|||.:..|||:||.||.|.::.... |.:.
 Frog   328 DVNQVVLCGGSARIPKLQQLIKDLFPEVEMLSSIPPDEVIPVGAAIQAGILIGKENLSTDLDTIT 392

  Fly   394 LDVTPLSLGI----ETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPG----VLIQVYE-GERAM 449
            ::.:...:.:    |:.....:||:...|.:|.::....     ..||    |.:::|| |.::.
 Frog   393 IECSASDILVKETDESGDNKFTVLLPSGTPLPARRQHVL-----QAPGHISSVCLELYESGGKSP 452

  Fly   450 TKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITI 503
            .:..  ..:..|..:.....||..|.....:..:|.|::|..::.:.|...||:
 Frog   453 VESK--FAQIVLKDLQKKASGVHDILTVLTMKRDGSLHITCTDKDSGKSEMITV 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 170/510 (33%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 147/376 (39%)
hspa14NP_001015780.1 HSPA14-like_NBD 2..376 CDD:212680 145/373 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.