DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hsp68

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_524474.1 Gene:Hsp68 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster

Alignment Length:648 Identity:461/649 (71%)
Similarity:550/649 (85%) Gaps:15/649 (2%)


  Fly     5 PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFD 69
            ||:|||||||||||||||:|||||||||||||||||||||||:||||||||||||||||..::||
  Fly     2 PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVFD 66

  Fly    70 AKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAY 134
            |||||||:|||:.:|.|:|||||:|::.:|||||.|.:|...|.|.|||||||||||||||||||
  Fly    67 AKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAY 131

  Fly   135 LGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFD 199
            ||.||.:|||||||||||||||||||||.|||:|||||||||||||:||||||...|||||||||
  Fly   132 LGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFD 196

  Fly   200 LGGGTFDVSILSIDDG-IFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRL 263
            |||||||||||:||:| :|||:||||||||||||||||||.||.:|||||:||||.:|.||||||
  Fly   197 LGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRSNPRALRRL 261

  Fly   264 RTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDK 328
            |||.|||||||||||:||:|||:|:||.|||:.::|||||||..||||:|::||||||:|||:||
  Fly   262 RTAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEKALKDAKMDK 326

  Fly   329 SVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLL 393
            |.|||||||||||||||||.|||:.|.||.||.|||||||||||||:|||||.||||.|::|:||
  Fly   327 SQIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAAILSGDKSSEIKDVLL 391

  Fly   394 LDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGK 458
            :||.|||||||||||||:.||:||:.||.||::|||||:||||.|.|||:|||||:|||||:||.
  Fly   392 VDVAPLSLGIETAGGVMTKLIERNSRIPCKQSKTFTTYADNQPAVTIQVFEGERALTKDNNVLGT 456

  Fly   459 FELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAE 523
            |:|:|:||||||||:|:||||:||||||||||.|:.|.....|||.|||||||:.||:||::|||
  Fly   457 FDLTGVPPAPRGVPKIDVTFDLDANGILNVTAKEQGTGNAKNITIKNDKGRLSQADIDRMLSEAE 521

  Fly   524 KYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLAD 588
            ||..|||:.::.|||:|.||:|.|.:|..  .:|...:||.:|:::|:::|:|.:||||:|..|:
  Fly   522 KYAEEDERHRQRIAARNQLETYLFGVKEA--AENGGDRISAADKSSIVERCSEAMKWLDSNTTAE 584

  Fly   589 KEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEVD 651
            |||||::.||||..|:||:||:::|         ||.|..   |...|....|..|||:||||
  Fly   585 KEEYEYKLKELEQFCSPIMTKMHKG---------GGDGQQ---APNFGQQAGGYKGPTVEEVD 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 447/608 (74%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 304/376 (81%)
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 460/647 (71%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 304/376 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281060291
eggNOG 1 0.900 E1_COG0443
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 P PTHR19375
RoundUp 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.