DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hsc70-2

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_524339.1 Gene:Hsc70-2 FlyBaseID:FBgn0001217 Length:633 Species:Drosophila melanogaster

Alignment Length:653 Identity:451/654 (69%)
Similarity:529/654 (81%) Gaps:23/654 (4%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            |.|.||:|||||||||||||:|:.||||||||||||||||||||.:|||||||.||||||||...
  Fly     1 MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVAMNAKN 65

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |:|||||||||||||..:|.|:|.|||:|::..|||||||.:|.|:|.|.||||||||||||:|.
  Fly    66 TVFDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEEISSMVLTKMREI 130

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            ||.|||..|.:||:||||||||||||||||||:|||||||||||||||||:||||||...|||||
  Fly   131 AEVYLGGKVKDAVVTVPAYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAYGLDKNLKGERNV 195

  Fly   196 LIFDLGGGTFDVSILSIDDG-IFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRA 259
            |||||||||||||:||||:| :||||:|||||||||||||||||.||.:|||||||.|:..|.||
  Fly   196 LIFDLGGGTFDVSVLSIDEGSLFEVKATAGDTHLGGEDFDNRLVNHFAEEFKRKHKSDIKGNARA 260

  Fly   260 LRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDA 324
            |||||||||||||||||||:||:|||:|.||.|||:.|:||||||||.|||||||.|||:||.||
  Fly   261 LRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKISRARFEELNMDLFRSTMQPVERALSDA 325

  Fly   325 KLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ 389
            |:||..|||:|||||||||||:|:||||||.||:||.|||||||||||||||||||.|..|.::|
  Fly   326 KMDKKAIHDVVLVGGSTRIPKIQKLLQDLFGGKQLNLSINPDEAVAYGAAVQAAILTGVGSSQIQ 390

  Fly   390 DLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNN 454
            ||||:||.|||||||||||||:.|::||..||.||.|.||||||||..|.|||||||||||||||
  Fly   391 DLLLVDVAPLSLGIETAGGVMTNLVERNARIPCKQQQIFTTYSDNQNAVTIQVYEGERAMTKDNN 455

  Fly   455 LLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMV 519
            |||.|.|:||||||||||||||.||::|:|||||.|.:.||.|..||||:||||||||.:|:||:
  Fly   456 LLGTFNLTGIPPAPRGVPQIEVAFDLNADGILNVNAKDNSTGKSEKITISNDKGRLSKAEIDRML 520

  Fly   520 NEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDAN 584
            :|||||:.||::|:|.:.:||.||:|.:..:..:| |.....:|:::|:.:.|||:....|||.|
  Fly   521 SEAEKYKVEDDRQRERVQSKNNLEAYIYACRQAVD-DAPSGVLSETERSKVRDKCSSEASWLDKN 584

  Fly   585 QLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAG-GAGPTIE 648
            .||:|||:|...||.:.:|.||::|::                    .|..|.:..| |:.||:|
  Fly   585 SLAEKEEFESHLKECQRICTPIMSKIH--------------------GGKKGKSSMGKGSHPTVE 629

  Fly   649 EVD 651
            |||
  Fly   630 EVD 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 441/612 (72%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 301/376 (80%)
Hsc70-2NP_524339.1 PTZ00009 1..632 CDD:240227 450/652 (69%)
HSPA1-2_6-8-like_NBD 6..382 CDD:212675 301/376 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281060221
eggNOG 1 0.900 E1_COG0443
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 P PTHR19375
RoundUp 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.