DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa9

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001001229.1 Gene:hspa9 XenbaseID:XB-GENE-960228 Length:670 Species:Xenopus tropicalis

Alignment Length:605 Identity:317/606 (52%)
Similarity:409/606 (67%) Gaps:43/606 (7%)


  Fly     3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNPTQT 66
            |...:|||||||.|||.:.:..:.:::.|.:|.|||||.||| :|.|||:|..||.|...||..|
 Frog    46 KGAVIGIDLGTTNSCVAIMEGKQAKVLENSEGARTTPSVVAFSSDAERLVGMPAKRQAVTNPNNT 110

  Fly    67 IFDAKRLIGRKFDDAAVQSDMKHWPFEVVSA-DGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            .:..||||||:|||..||.|:|:.||::|.| :|...:|    ...|.:.|.:|.:.||.|||||
 Frog   111 FYATKRLIGRRFDDPEVQKDIKNVPFKIVKASNGDAWLE----SHGKLYSPSQIGAFVLMKMKET 171

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            ||.|||....||||||||||||||||||||||.|:||||||:||||||||:||||||.  .::.:
 Frog   172 AENYLGHAAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKS--DDKII 234

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            .::||||||||:|||.|..|:||||||.|||.|||||||..|:.|.|::|||:...|||.:..||
 Frog   235 AVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLQHIVKQFKRESGVDLTKDNMAL 299

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTD----FYTSITRARFEELNADLFRSTMDPVEKAL 321
            :|:|.|.|:||..|||:.|..|.:..|.....    ....:|||:||.:.|||.:.|:.|.:||:
 Frog   300 QRVREAAEKAKCELSSALQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVADLIKRTVAPSQKAM 364

  Fly   322 RDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQ 386
            :||::.||.|.:::||||.||:||||:.:|||| |:..:|::|||||||.|||:|..:|.||   
 Frog   365 QDAEVGKSDIGEVLLVGGMTRMPKVQQTVQDLF-GRAPSKAVNPDEAVAIGAAIQGGVLAGD--- 425

  Fly   387 EVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTK 451
             |.|:||||||||||||||.|||.:.||.||||||||::|.|:|.:|.|..|.|:|::|||.|..
 Frog   426 -VTDVLLLDVTPLSLGIETLGGVFTKLIGRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAS 489

  Fly   452 DNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIE 516
            ||.|||:|.|.|||||||||||||||||||||||::|:|.::.|.:|.:|.| ...|.|||:|||
 Frog   490 DNKLLGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVI-QSSGGLSKDDIE 553

  Fly   517 RMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE--DNLKTKISDSDRTTILDKCNETIK 579
            .||..||||..||.::||.:.|.|..|....:.::.::|  |.|..           |:||:.  
 Frog   554 NMVKNAEKYAEEDRRRKERVEAVNNAEGIIHDTESKMEEFKDQLPA-----------DECNKL-- 605

  Fly   580 WLDANQLADKEEYEHRQKEL 599
                     |||.. :.|||
 Frog   606 ---------KEEIS-KVKEL 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 317/606 (52%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 205/381 (54%)
hspa9NP_001001229.1 dnaK 46..664 CDD:234715 317/606 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.