DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa4

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_989252.1 Gene:hspa4 XenbaseID:XB-GENE-952769 Length:835 Species:Xenopus tropicalis

Alignment Length:688 Identity:204/689 (30%)
Similarity:338/689 (49%) Gaps:97/689 (14%)


  Fly     7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAK 71
            ||.|||.....|.|.:.|.:|.:||:..:|:||:.::|....|.||.|||:||..|...|:...|
 Frog     4 VGFDLGFLSCYVAVARAGGIETVANEYSDRSTPACISFGPKNRSIGAAAKSQVISNAKNTLQGFK 68

  Fly    72 RLIGRKFDDAAVQSDMKHWPFEVVS-ADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            |..||.:.|..||::.....||:|. ..|...|:|.|.:|:::|..|::::|.|||:|||||:.|
 Frog    69 RFHGRAYTDPFVQAEKPGLAFELVELPTGSAGIKVVYLEEERSFTIEQVTAMQLTKLKETAESAL 133

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAV-----GERNV 195
            .|.|.:.|:.||::|.|::|::..||..|||||.||:|||.||.|:|||:.|:.:     ..|.|
 Frog   134 KKPVVDCVVAVPSFFTDAERRSVVDATQIAGLNCLRLINETTAVALAYGIYKQDLPAPEEKPRIV 198

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            :..|:|...:.||:.:.:.|..:|.:|:.|..|||..||:.||.:||:||.:|:|.|:.:..|.|
 Frog   199 VFADMGHSAYQVSVCAFNKGKLKVLATSFDPTLGGRKFDDVLVNYFVEEFGKKYKLDIKSKIRPL 263

  Fly   261 RRLRTACERAKRTLS-SSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDA 324
            .||...||:.|:.:| ::::..:.|:......|...|:.|..|||:...|......|:...|..|
 Frog   264 LRLAQECEKLKKLMSANASELPLNIECFMNDIDVTGSMNRGHFEEMCDSLLSRVEPPLRSVLEQA 328

  Fly   325 KLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ 389
            ||.|..|:.:.:|||:||||.|:..:...| |||::.::|.|||||.|.|:|.|||  ..:.:|:
 Frog   329 KLKKEDIYAVEIVGGATRIPAVKERIMRFF-GKEVSTTLNADEAVARGCALQCAIL--SPAFKVR 390

  Fly   390 DLLLLDVTPLSLGIE----TAGGVMSV-LIKRNTTIPTKQTQTF-TTYSDNQPGVLIQVYEGERA 448
            :..:.|:.|..:.::    ...|:... :..:|...|..:..|| ...|.|    |...|...:.
 Frog   391 EFSITDLVPYPISLKWNSPAEEGLSDCEVFPKNHAAPFSKVLTFYRKESFN----LDAYYSAPKE 451

  Fly   449 MTKDNNLLGKFELSG-IPPAPRGVPQIEVTFDIDANGILNVTA-----------------LERST 495
            :...:..||:|.:.. ||.|.....:::|...::.:||.:|::                 .::.|
 Frog   452 LPYPDPSLGQFHIQKVIPQADGSSSKVKVKVRVNIHGIFSVSSASLVEIHKTEDGEEPMETDQVT 516

  Fly   496 NKENKITI----------------------------TNDK------------------------- 507
            .:|.|:.:                            |.||                         
 Frog   517 KEEEKMQVDQEEAKPEENQQAESKTNPDEMETSQPGTKDKKTDQPPQAKKAKVKTSTVDLPIEHY 581

  Fly   508 --GRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTK-ISDSDRTT 569
              .::.::.:...|....|...:|:.:||...|||.:|.|.:.|:..|  ..:..| :|:.||.:
 Frog   582 PPWQIGRDMLNLFVENEGKMIMQDKLEKERNDAKNAVEEYVYEMRDKL--SGIYEKFVSEDDRNS 644

  Fly   570 ILDKCNETIKWL-DANQLADKEEYEHRQKELEGVCNPI 606
            .:.|..:|..|| :..:...|:.|..:..:|:.:.|||
 Frog   645 FILKLEDTENWLYEDGEDQPKQVYIDKLNDLKKLGNPI 682

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 204/689 (30%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 150/381 (39%)
hspa4NP_989252.1 HSPA4_NBD 2..384 CDD:212687 150/383 (39%)
HSP70 3..604 CDD:278441 180/607 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.