DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa5

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_998223.1 Gene:hspa5 ZFINID:ZDB-GENE-031001-11 Length:650 Species:Danio rerio

Alignment Length:620 Identity:397/621 (64%)
Similarity:501/621 (81%) Gaps:6/621 (1%)


  Fly     2 SKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNPTQ 65
            |....:|||||||||||||:::|:|||||||||||.||||||| |:.|||||||||||:..||..
Zfish    24 SVGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTTEGERLIGDAAKNQLTSNPEN 88

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTY-KDEKKTFFPEEISSMVLTKMKE 129
            |:|||||||||.:.|::||.|:|::||:|:....||.|::.. ..:.|||.|||||:||||||||
Zfish    89 TVFDAKRLIGRTWGDSSVQQDIKYFPFKVIEKKNKPHIQLDIGSGQMKTFAPEEISAMVLTKMKE 153

  Fly   130 TAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERN 194
            ||||||||.||:||:||||||||:||||||||||||||||:|||||||||||||||||:. ||:|
Zfish   154 TAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKRD-GEKN 217

  Fly   195 VLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRA 259
            :|:|||||||||||:|:||:|:|||.:|.|||||||||||.|::.||::.:|:|..||:..:.||
Zfish   218 ILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRA 282

  Fly   260 LRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDA 324
            :::||...|:|||.||:..||.|||:|.|||.||..::|||:|||||.|||||||.||:|.|.|:
Zfish   283 VQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDS 347

  Fly   325 KLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ 389
            ...|..|.:||||||||||||:|:|:::.|||||.::.|||||||||||||||.:|.|:  :|..
Zfish   348 DPKKPDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGE--EETG 410

  Fly   390 DLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNN 454
            ||:||||.||:|||||.||||:.||.|||.:|||::|.|:|.|||||.|.|:||||||.:||||:
Zfish   411 DLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNH 475

  Fly   455 LLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMV 519
            |||.|:|:||||||||||||||||:||.||||.|||.::.|..:||||||||:.||:.|||||||
Zfish   476 LLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMV 540

  Fly   520 NEAEKYRNEDEKQKETIAAKNGLESYCFNMKATL-DEDNLKTKISDSDRTTILDKCNETIKWLDA 583
            ||||::.:||:|.||.|.::|.||||.:::|..: |::.|..|:|..|:..|.....|.|:||:|
Zfish   541 NEAERFADEDKKLKERIDSRNELESYAYSLKNQIGDKEKLGGKLSSEDKEAIEKAVEEKIEWLEA 605

  Fly   584 NQLADKEEYEHRQKELEGVCNPIITKLYQGAGFPP 618
            :|.||.||::.::||||.|..||::|||..||.||
Zfish   606 HQDADLEEFQAKKKELEEVVQPIVSKLYGSAGGPP 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 393/613 (64%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 255/377 (68%)
hspa5NP_998223.1 HSPA5-like_NBD 26..401 CDD:212681 254/376 (68%)
PTZ00009 29..641 CDD:240227 396/616 (64%)
Periplasmic_Binding_Protein_Type_2 <583..640 CDD:304360 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.