DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and F11F1.1

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001255199.1 Gene:F11F1.1 WormBaseID:WBGene00008714 Length:607 Species:Caenorhabditis elegans

Alignment Length:598 Identity:259/599 (43%)
Similarity:374/599 (62%) Gaps:11/599 (2%)


  Fly     6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNPTQTIFD 69
            ::|||||||:|||..:|:|:|.|:.|:.|.|||||.:|. .|.:.|||..||:.:. ..|.::||
 Worm     2 SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVIG-KATNSLFD 65

  Fly    70 AKRLIGRKFDDAAVQSDMKHWPFEVVSAD-GKPKIEVTYKDEKK-TFFPEEISSMVLTKMKETAE 132
            .||:|||::||..:|.||..|||:|...| |.|.:|: :|:||. .|....:||::|..:|..||
 Worm    66 VKRIIGRRYDDVLLQRDMPLWPFKVEKDDNGIPYLEI-HKNEKPLKFSAVTVSSLILRCLKYNAE 129

  Fly   133 AYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLI 197
            ..||..|.:||||||||||.:||:||::|..||||.||||:||||||||||.|..:.:..||:||
 Worm   130 RKLGLEVKSAVITVPAYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILI 194

  Fly   198 FDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRR 262
            :|||||||||:.:::|.....||:..|||||||:|.||.::...::|||.:|..||..|.|||:|
 Worm   195 YDLGGGTFDVAAVNVDGPRITVKAKGGDTHLGGQDIDNIIMIKMLEEFKNRHGIDLKGNYRALKR 259

  Fly   263 LRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLD 327
            :|.|.|.||.|||:|:.|.||::.|..|.||...|:|..||....:|..:|:..||:.:|:|.|.
 Worm   260 IRKAAEVAKITLSASSVARIELECLHLGIDFIMRISRTDFESWIENLLMATVIHVERVIREANLK 324

  Fly   328 KSVIHDIVLVGGSTRIPKVQRLLQDLF-NGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDL 391
            ||.|::|||||||||||.::.:::..| :...:.:||:||||||||||:.||:|.|  ::||||:
 Worm   325 KSQINEIVLVGGSTRIPILKNIIKQSFESNTRICESIHPDEAVAYGAAIMAAVLSG--AEEVQDM 387

  Fly   392 LLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLL 456
            .|:||.|:|:|::.....||||||:.|..|..:.:||....|.|..:.:.||||||.:...|..|
 Worm   388 RLIDVIPMSIGVQCNRDYMSVLIKKGTVFPCTKRKTFINSDDFQTSINVPVYEGERVLCSHNRQL 452

  Fly   457 GKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNE 521
            |:..|. |.|..||...:::|.::|.||||..|||:.:|.|....||..|....::.:|:.|.::
 Worm   453 GEISLP-IQPKRRGESVVDITLEVDYNGILQATALDLNTKKAITTTILYDCCTYTQPEIDEMTSQ 516

  Fly   522 AEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQL 586
            :|:.|..||..|.........|...:..|..|::  :|..:.....:.:::.....|.||.....
 Worm   517 SEEDRIFDEHFKMRYKQLQKSEDMAYGYKHRLEK--VKGSVEPGKFSNLMETVEREISWLSVFPK 579

  Fly   587 ADKEEYEHRQKEL 599
            ....||..|::.|
 Worm   580 VSPNEYMQRRRAL 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 259/599 (43%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 190/379 (50%)
F11F1.1NP_001255199.1 NBD_sugar-kinase_HSP70_actin 2..379 CDD:302596 190/379 (50%)
HSP70 3..598 CDD:278441 259/598 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.