DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa4a

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_999881.1 Gene:hspa4a ZFINID:ZDB-GENE-040426-2832 Length:833 Species:Danio rerio

Alignment Length:690 Identity:204/691 (30%)
Similarity:345/691 (50%) Gaps:97/691 (14%)


  Fly     7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAK 71
            ||.|:|.....|.|.:.|.:|.:||:..:|.|||:|:|....|.||.|||:||..|...|:...|
Zfish     4 VGFDVGFQSCYVAVARAGGIETVANEYSDRCTPSFVSFGPRNRSIGAAAKSQVVTNCKNTVQGFK 68

  Fly    72 RLIGRKFDDAAVQSDMKHWPFEVVS-ADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            |..||.|.|..|::......:::.. .:|...|:|.|.:|:|.|..|::::|:|||:|||||:.|
Zfish    69 RFHGRAFSDPYVETTQSSLVYDLAQMPNGTTGIKVMYMEEEKLFGIEQVTAMLLTKLKETAESAL 133

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAV-----GERNV 195
            .|.|.:.||:||:||.|::|::..||..|||||.||::|:.||.|:|||:.|:.:     ..|.|
Zfish   134 KKPVADCVISVPSYFTDAERRSVMDAAQIAGLNCLRLMNDTTAVALAYGIYKQDLPAPEEKPRTV 198

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            :..|:|...:.||..:.:.|..:|..:|.|..|||:|||..||.||.:||.:|:|.|:.:..|||
Zfish   199 VFVDVGHAGYQVSACAFNKGKLKVLGSAFDPELGGKDFDEVLVKHFCEEFAQKYKLDVRSKPRAL 263

  Fly   261 RRLRTACERAKRTLS-SSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDA 324
            .||...||:.|:.:| :|:...:.|:......|..:.:.||:||||.|.|......|::..:...
Zfish   264 VRLYQECEKLKKLMSANSSDLPLNIECFMNDIDVSSKLNRAKFEELCAGLLAKVEAPLQSIMEQT 328

  Fly   325 KLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ 389
            :|.|..|:.:.::||::|||.::..:...| ||||:.::|.|||||.|.|:|.|||  ..:.:|:
Zfish   329 RLKKEDIYAVEIIGGASRIPAIKERISKFF-GKELSTTLNLDEAVARGCALQCAIL--SPAFKVR 390

  Fly   390 DLLLLDVTPLSLGIETAG----GVMSV-LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAM 449
            :..:.||.|..:.::...    ||... :..:|...|..:..||..   .:|..|...|...:|:
Zfish   391 EFSITDVVPYPISLKWTSAADEGVSDCEVFPKNHAAPFSKVLTFYR---KEPFTLEAYYNNPKAL 452

  Fly   450 TKDNNLLGKFELSGIPPAPRG-VPQIEVTFDIDANGILNVTA---------------LERST--- 495
            ...:..:|:|.:..:.|...| ..:::|...::.:|:.:|::               :|..|   
Zfish   453 PYPDPTIGQFTIHKVVPQASGESSKVKVKVRVNVHGVFSVSSASLVELLKPGEGEEPMETDTPAK 517

  Fly   496 NKENKITITND---------KGRLSK----EDIERMVNEAEKYRN-------------------- 527
            ::|||:.:..:         |.:..|    ||:|....:.::.:|                    
Zfish   518 DEENKMQVDQEAQKAQADDQKEQADKKSDTEDMETSPEDKQEKKNDQPPQAKKAKVKTKTVDLPI 582

  Fly   528 -------------------------EDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDR 567
                                     :|:.:||...|||.:|.|.:.|:..| ...|:..:|:::|
Zfish   583 MNSLQWQLASDALNLFMENEGKMIMQDKLEKERNDAKNYVEEYVYEMRDKL-HGVLENFVSEAER 646

  Fly   568 TTILDKCNETIKWL-DANQLADKEEYEHRQKELEGVCNPI 606
            .:...|..:|..|| :..:...|:.|..:..||:.:.:||
Zfish   647 DSFSLKLEDTENWLYEEGEDQQKQVYIDKLAELKKLGDPI 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 204/691 (30%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 149/381 (39%)
hspa4aNP_999881.1 NBD_sugar-kinase_HSP70_actin 2..384 CDD:302596 149/383 (39%)
HSP70 3..692 CDD:278441 204/691 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.